(data stored in ACNUC1104 zone)

EMBL: CP002026.PE334

CP002026.PE334       Location/Qualifiers
FT   CDS_pept        complement(335352..336314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0338"
FT                   /product="Luciferase-like, subgroup"
FT                   /note="PFAM: Luciferase-like, subgroup; KEGG: bja:blr5498
FT                   putative oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87671"
FT                   /db_xref="GOA:D7A255"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:D7A255"
FT                   /inference="protein motif:PFAM:PF00296"
FT                   /protein_id="ADH87671.1"
FT                   /translation="MAKSGEQPSPHSAPLPAACWSPSPRVAFNSSRRWAAIAARTKRIR
FT                   LGSAVTVLSSDDPIRVFQRFATVDAISNGRAEVILGRGSFTESFPLFGFDLKDYEALFS
FT                   EKLDLFAALLKDNGTADGVTWNGNLRPPLEKQHVYPLVESGTLKTWIGVGGSPESVVRA
FT                   ARYGLPLMLAIIGGDPARFAPYVDLYHRAVDQLGGVAHPIGVHSPGYVAETDEQAREEF
FT                   FADYKRMRDRIGAERGWPPMGRDEFEREVTRGSLYLGSPETVARKIAKTATTLGIGRFD
FT                   MKYSAGPLAHEKSMKCIELYGRQVIPRVRELLAQEKVEA"
     ttggcgaagt ccggagaaca gccttctcca cattcggcgc cgctgccagc ggcctgctgg        60
     tcgccgtcgc cacgggtagc gttcaattca tcaaggcggt gggccgccat cgccgcgcgc       120
     acgaagcgca tccggctcgg ctcggcggtg acggtgctct cctccgatga tccgatccgc       180
     gtgttccagc gtttcgcgac ggtcgacgcc atctccaacg ggcgggccga ggtgatcctc       240
     gggcgcggct ccttcaccga atccttcccg ctcttcggct tcgacctgaa ggattacgag       300
     gcgctgttca gcgagaagct cgacctgttc gccgcgctgc tgaaggacaa cggcacggcc       360
     gacggcgtga cctggaacgg caatctgcgc ccgccgctgg agaagcagca cgtctatccg       420
     ctggtcgaga gcggcacgct gaagacctgg atcggcgtcg gcggctcgcc ggaatcggtg       480
     gtgcgcgccg cgcgctacgg cctgccgctg atgctcgcca tcatcggcgg cgatccggcc       540
     cgcttcgcgc cctatgtcga tctctaccac cgcgcggtgg accagctcgg cggcgtggcg       600
     catcccatcg gcgtgcattc gccgggctat gtcgccgaaa cggacgagca ggcgcgcgag       660
     gagttcttcg ccgactacaa gcgcatgcgc gaccgcatcg gcgccgagcg cggctggccg       720
     cccatgggcc gcgacgagtt cgagcgcgag gtcacgcgcg gctcgctcta tctcggctcg       780
     cccgagacgg tggcgcggaa gatcgccaag accgcgacga cgctcggcat cggccgcttc       840
     gacatgaagt acagcgccgg cccgctggcg catgagaagt cgatgaagtg catcgagctc       900
     tatggccggc aggtcatccc gcgcgtgcgg gaactgctgg cgcaggagaa ggtggaggcg       960
     tag                                                                     963
//

If you have problems or comments...

PBIL Back to PBIL home page