(data stored in ACNUC1104 zone)

EMBL: CP002026.PE335

CP002026.PE335       Location/Qualifiers
FT   CDS_pept        336519..337403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0339"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: xau:Xaut_4653 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87672"
FT                   /db_xref="GOA:D7A256"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7A256"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADH87672.1"
FT                   /translation="MTVLLDIDQLRTFIAIAETGSFTKAADVVHKTQSAVSMQMKRLEE
FT                   RVGKAIFARDGRASRLTDEGDRLLDYARRIVKLNMEAVASLASAELSGRVRLGVPDDYA
FT                   DRYLPEIMARFSNTHPNVELTVVCDPSTDLIDRIDTGDLDLAIVTDCEMINRETEIIRR
FT                   EQLLWVGSNRHPVHLEDPVPLALGRQTCNWRQEAISMLQAVGRPFRILYTSSNSTAVSA
FT                   AVLSGLAISVLPESGLRPGMRVLGPSDGFPALAPCRIGLLRNRHEASPLADALANHIVQ
FT                   GLDNISEAAIAAE"
     atgaccgtgc tgctcgatat tgatcaatta agaacattca tcgcaatcgc cgaaaccggc        60
     agcttcacaa aggccgccga tgtggttcac aagacccagt cggccgtctc catgcagatg       120
     aagcggctgg aggaaagggt cggcaaggcg atcttcgcgc gcgacgggcg tgcctcgcgc       180
     ctcaccgacg agggcgaccg gctgctcgat tacgcaaggc ggatcgtgaa gctgaacatg       240
     gaggcggtgg cgagcctcgc ctccgccgag ctttcgggac gggtacggct cggcgtgccg       300
     gacgactatg ccgaccgcta tctgccggag atcatggcac ggttctccaa cacccatccc       360
     aatgtcgagc tgaccgtggt gtgcgatccc tcgaccgacc tcatcgaccg catcgacacc       420
     ggcgacctcg acctcgccat tgtcaccgat tgcgagatga tcaaccgcga gaccgagatc       480
     atccgccgcg agcagctgct ctgggtcggc tccaaccgcc acccggtgca tctcgaggac       540
     cccgtgccgc tggcgctggg gcggcagacc tgcaactggc ggcaggaggc gatatccatg       600
     ctgcaggcgg tcggccggcc gttccgcatc ctctacacct cctcgaacag cacggcggtc       660
     tcggcggcgg tgctctccgg cctcgccatc tcggtgctgc cggaatcggg gctgcgcccc       720
     ggcatgcggg tgctcggtcc ctcggacggc ttccccgcgc tggcgccctg tcgcatcggc       780
     ctcctgcgca accggcacga ggcttcgccg ctggcggacg ccctcgccaa ccacatcgtc       840
     cagggcctcg acaacatctc ggaagccgcc atagcggcgg agtaa                       885
//

If you have problems or comments...

PBIL Back to PBIL home page