(data stored in ACNUC1104 zone)

EMBL: CP002026.PE338

CP002026.PE338       Location/Qualifiers
FT   CDS_pept        complement(339818..340495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0342"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: ErfK/YbiS/YcfS/YnhG family protein; KEGG:
FT                   mdi:METDI0732 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87675"
FT                   /db_xref="GOA:D7A259"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:D7A259"
FT                   /inference="protein motif:PFAM:PF03734"
FT                   /protein_id="ADH87675.1"
FT                   /translation="MPIHRRSLLLGAPFLLAGCTTARRQEPTPVARSLAYAPSYETMYA
FT                   ALDGEPYPVPAVDLSQIDPRFLRREVAYATREEPGTIVVDVEARYAYLVMENGRALRYG
FT                   VGVGKEEGFNFRGAATIARKAEWPRWTPTPDMIRREPERYAKYAGGLPGGPGNPLGPRA
FT                   LYLYRDGRDTLYRLHGTIEPWTIGTMVSSGCIRLLNQDIIDLYRRVPAGSRAVVLSSAG
FT                   TAA"
     atgcccatcc accgacgcag cctgcttctc ggcgcgccct tccttctcgc cggctgcacc        60
     acggcgcgcc ggcaggaacc gacgccggtc gcccgctccc ttgcctatgc gccgtcctac       120
     gagaccatgt atgccgcgct cgacggcgag ccctatcccg tcccggccgt cgatctgtcg       180
     cagatcgacc cgcgcttcct aaggcgcgag gtcgcctacg ccacccgcga ggagcccggc       240
     accatcgtcg tcgacgtcga ggcccgctac gcctatctcg tcatggagaa cggccgggcg       300
     ctgcgctatg gcgtcggcgt cggcaaggag gaaggcttca acttccgcgg cgcggcgacc       360
     attgcccgca aggccgagtg gccgcgctgg acgccgaccc cggacatgat ccgccgcgag       420
     cccgagcgct acgccaaata tgccggcggc ctgccgggcg ggccgggcaa cccgctcggt       480
     ccccgcgcgc tctatctcta tcgcgacggg cgcgacacgc tgtaccggct gcacgggacg       540
     atcgaaccct ggaccatcgg caccatggtc tcctccggct gcatccggct gctgaaccag       600
     gacatcatcg acctctaccg gcgcgtgccg gcgggaagcc gcgccgtggt cctgagctcc       660
     gccggcaccg ccgcgtaa                                                     678
//

If you have problems or comments...

PBIL Back to PBIL home page