(data stored in ACNUC1104 zone)

EMBL: CP002026.PE339

CP002026.PE339       Location/Qualifiers
FT   CDS_pept        340607..341521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0343"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: bid:Bind_0309 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87676"
FT                   /db_xref="GOA:D7A260"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7A260"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADH87676.1"
FT                   /translation="MDLAAALRAFVRTVERGSVTAAARDLAVTQPAVTKHLRNLERHVG
FT                   ARLLERSARLVRPTPQGAALYETSRSALASIDSALEGVRRDMGAIEGTLRIHAPACLGA
FT                   RRLHGIVMEFQAAHPGVNVDLILENRSVDLVYENLDLAVKYGRPEGQDLVIRRLGLVRR
FT                   VLVAAPSFLARCGPVDTLERLSEVDIVTTPAVVSPRDMLMLQRAGTPLGESIEVPVRPV
FT                   LRTNAAEVIEQTLLGGHAAGPVQVLFAARDLAAGRLVRLLPEYEVRPSEAFLAYPSVRF
FT                   MRPVVRAFTDFAVPALRATEGIT"
     atggatctcg cggccgccct gcgcgccttc gtgcgcaccg tcgagcgcgg ctcggtgacg        60
     gcggcggcac gcgacctcgc cgtgacgcaa ccggcggtca ccaagcatct gcgcaatctg       120
     gaacgccatg tcggcgcccg gctgctggag cgctcggcgc ggctcgtgcg tcctacgccg       180
     cagggcgcgg cgctctacga gacgagccgc tcggcactcg cctccatcga ttcggcgctg       240
     gaaggcgtgc ggcgcgacat gggcgccatc gaggggacgc tgcgcatcca cgcgcccgcc       300
     tgcctcggcg cgcggcggct gcacggcatc gtcatggagt tccaggccgc gcatcccggc       360
     gtcaacgtcg atctcatcct ggagaaccgc agcgtcgatc tcgtctacga gaatctggac       420
     ctcgcggtga aatatggccg gccggaaggg caggacctgg tcatccggcg gctggggctg       480
     gtgcggcggg tgctggtggc ggcgccgagc ttcctggccc gctgcggccc cgtcgacacg       540
     ctggagcgcc tgtcggaggt cgacatcgtc accacgccgg cggtggtatc gccacgcgac       600
     atgctgatgc tgcagcgtgc cgggacccct ctgggcgaat ccatcgaggt gccggtgcgt       660
     ccggtcctgc gcaccaacgc cgccgaagtg atcgagcaga cgctgctggg gggccatgcg       720
     gccgggccgg tgcaggtgct gttcgccgcg cgcgatctgg cggcgggacg gctcgtaagg       780
     ctgctgccgg agtacgaggt gcgcccgtcc gaggcgttcc tcgcctatcc ctcggtgcgc       840
     ttcatgcgtc cggtggtgcg ggccttcacc gatttcgccg tgccggcgct gcgggcgacg       900
     gaggggatca cctga                                                        915
//

If you have problems or comments...

PBIL Back to PBIL home page