(data stored in ACNUC1104 zone)

EMBL: CP002026.PE348

CP002026.PE348       Location/Qualifiers
FT   CDS_pept        349344..350942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0352"
FT                   /product="RNA polymerase, sigma 54 subunit, RpoN"
FT                   /note="KEGG: rpa:RPA0050 RNA polymerase factor sigma-54;
FT                   TIGRFAM: RNA polymerase sigma-54 factor, RpoN; PFAM:
FT                   sigma-54 DNA-binding domain protein; sigma-54 factor
FT                   core-binding region; sigma-54 factor"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87685"
FT                   /db_xref="GOA:D7A2W7"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:D7A2W7"
FT                   /inference="protein motif:TFAM:TIGR02395"
FT                   /protein_id="ADH87685.1"
FT                   /translation="MSLSPRLEFRQTQSLVMTPQLMQAIKLLQLSNLDLVAYVEAELER
FT                   NPLLERQVEPEGERPAEMEGEGGDQLERVSDADLDPRASHASEAADGERDERVSDWLEE
FT                   RLETSRSAIEDRLDTTLENVYPDDAVREPTGLAPGGEAPAYSEWAGVGTGGRDDDGYNL
FT                   EAFVSAETTLADHLEGQLALAVSNPVERLIGQNLIDLIDEAGYLSADLAGVAERLGAPL
FT                   AQVEKVLAVVQGFDPPGIGARSLSECLAIQLKERNRYDPCMAALLSHLELLARREFTTL
FT                   KRVCGVDDEDLAEMVGEIRRLNPKPGLAFGSGVIQPIVPDVFVRGGPDNWLVELNADTL
FT                   PRVLVNQAYYSRVQKTTRNDREKAFLSDCMQTATWLTRSLDQRARTILKVATEIVRQQD
FT                   AFLTLGVQHLRPLNLRMVADAIGMHESTVSRVTSNKYMATPRGIFEMKYFFSSSISASD
FT                   GGEAHSAESVRFRIKQMIDAESPDDVLSDDTLVQRLREAGIDIARRTVAKYREAMRIPS
FT                   SVQRRREKQAALSAG"
     atgtcgctga gcccgcgcct cgaattccgc cagacccagt ctctggtgat gacgccgcag        60
     ctcatgcagg cgatcaagct gctgcagctc tccaatctcg atctcgtcgc ctatgtcgag       120
     gcggagctgg agcgcaaccc gctgctggag cgtcaggtcg agccggaggg cgagcgcccg       180
     gcggagatgg agggggaggg cggcgaccag ctggagcggg tgagcgacgc cgatctcgat       240
     ccccgcgcca gccacgcctc cgaggccgcg gatggcgagc gcgacgagcg tgtctccgac       300
     tggctggagg agcggctcga aaccagccgc agcgccatcg aggaccggct cgacaccacg       360
     ctggagaatg tctaccccga cgacgccgtc cgcgagccca cgggcctcgc accgggcggc       420
     gaggcgccgg cctattcgga atgggcgggc gtcggcaccg gcgggcgcga cgatgacggc       480
     tacaatctcg aagccttcgt ctccgccgag acgacgctcg ccgaccacct cgaaggccag       540
     ttggcgctcg ccgtgagcaa tccggtggag cggctgatcg gccagaacct gatcgatctg       600
     atcgacgagg ccggctacct ctccgccgac cttgccggcg tcgccgagcg gctcggtgcg       660
     ccgctggcgc aggtggagaa ggttctcgcc gtggtgcagg gcttcgaccc gccgggcatc       720
     ggcgcgcgct cgctctccga gtgcctcgcc atccagctca aggaacgcaa ccgctacgac       780
     ccgtgcatgg cggcgctgct gagccatctg gaactgctgg cgcggcgcga attcaccacg       840
     ctgaagcggg tctgcggcgt cgacgacgag gacctggcgg agatggtcgg tgagatccgc       900
     cggctcaatc ccaagcccgg cctcgccttc ggctccggcg tcatccagcc gatcgtgccg       960
     gacgtgttcg tgcgcggcgg gccggacaac tggctggtcg agctcaacgc cgacacgctg      1020
     ccgcgcgtgc tggtcaacca ggcctattat tcgcgggtgc agaagaccac gcgcaacgac      1080
     cgcgaaaagg ccttcctgtc ggactgcatg cagaccgcta cctggctgac ccgctcgctc      1140
     gaccagcgcg cccgcaccat cctcaaggtg gcgaccgaga tcgtgcgcca gcaggacgcc      1200
     ttcctcaccc tgggcgtgca gcacctgcgc cccttgaacc tgcgcatggt ggccgacgcc      1260
     atcggcatgc acgaatccac cgtctcgcgc gtgacctcga acaaatacat ggcgacgccg      1320
     cgcggaatct tcgagatgaa gtatttcttc tcgtcttcca tttccgcatc cgacggcggc      1380
     gaagcacatt cggccgaatc ggtgcgcttc cgcatcaagc agatgatcga cgcggagagc      1440
     ccggacgacg tgctctccga cgacacgctg gtgcaacgcc tgcgcgaagc cggcatcgac      1500
     atcgcccgcc gcacggtggc gaaatatcgc gaggcgatgc gcatcccctc ctcggtgcag      1560
     cgccggcgcg agaagcaggc cgcgctctcg gccggctga                             1599
//

If you have problems or comments...

PBIL Back to PBIL home page