(data stored in ACNUC1104 zone)

EMBL: CP002026.PE349

CP002026.PE349       Location/Qualifiers
FT   CDS_pept        351116..351709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0353"
FT                   /product="ribosomal subunit interface protein"
FT                   /note="KEGG: xau:Xaut_2035 sigma 54 modulation
FT                   protein/ribosomal protein S30EA; TIGRFAM: ribosomal subunit
FT                   interface protein; PFAM: sigma 54 modulation
FT                   protein/ribosomal protein S30EA"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87686"
FT                   /db_xref="GOA:D7A2W8"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR034694"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="InterPro:IPR038416"
FT                   /db_xref="UniProtKB/TrEMBL:D7A2W8"
FT                   /inference="protein motif:TFAM:TIGR00741"
FT                   /protein_id="ADH87686.1"
FT                   /translation="MPLRVSGKNIDVGEALRQRVADRVAGAMGKYFDGGWSGHVTVARE
FT                   GSGYRSDCALHLDSGTILQAHADAQDPYSSADAAVERIETRLRRYKSRIKRRAANGEGE
FT                   GLAETVPLTVFSTPDHEDAELLEGWNPTVVCEATANLPRLSVSDAVLELDFTGAAVLVF
FT                   RHAGHGRINVVYRRGDGHVGWVDPPVSAVTEEVH"
     atgccgctgc gggtttcagg aaaaaatatc gatgtgggcg aggcgctgag gcagcgtgtg        60
     gctgaccgcg tcgctggcgc catgggcaaa tatttcgatg gcggctggtc cggccacgtc       120
     acggtcgccc gcgaaggctc cggctaccgc tcggactgtg cgctgcatct cgacagcggc       180
     acgatcctgc aggcgcatgc cgacgcgcag gatccctatt ccagcgccga tgccgcggtg       240
     gagcggatcg agacgcggct gcgccgctac aagagccgca tcaagcgccg ggccgccaac       300
     ggcgaaggcg aggggctggc cgagacggtg ccgctcaccg tgttctcgac ccccgaccac       360
     gaggacgccg aactcctgga agggtggaac ccgaccgtgg tgtgcgaggc gaccgccaac       420
     ctgccgcggc tctcggtcag cgacgcggtg ctggaactcg atttcaccgg cgccgcggtg       480
     ctggtcttcc gccatgccgg gcacgggcgc atcaacgtcg tgtaccggcg cggcgacggt       540
     catgtcggct gggtcgatcc gccggtcagt gctgtgacgg aagaagtcca ttga             594
//

If you have problems or comments...

PBIL Back to PBIL home page