(data stored in ACNUC1104 zone)

EMBL: CP002026.PE35

CP002026.PE35        Location/Qualifiers
FT   CDS_pept        27813..28172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0035"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rlt:Rleg2_0752 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87372"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZV8"
FT                   /inference="similar to AA sequence:KEGG:Rleg2_0752"
FT                   /protein_id="ADH87372.1"
FT                   /translation="MLGLLDTIKIGAGLIAGVSLTWAAQTAYDRLVDDPAVAAAAREGY
FT                   VQIAEKTALQAQLAELSRQRAASDEALRAALARAENAKQEAARAQAQYDDLVVQDSGAD
FT                   GARVDGSDVQWLRDY"
     atgctcggcc tcctcgacac catcaagatc ggcgccggcc tcatcgccgg cgtctcgctc        60
     acctgggcgg cccagaccgc ctatgaccgg ctcgttgacg atccggccgt cgctgccgcc       120
     gcccgcgagg gctacgtgca gatcgccgag aagacggctc ttcaggcgca actcgccgaa       180
     ctcagccgcc agcgcgccgc ttccgatgaa gcgctgcgcg ccgcactcgc ccgtgccgaa       240
     aacgccaagc aggaggctgc ccgtgcccaa gctcaatatg acgacctggt cgtgcaggac       300
     agcggcgctg acggcgctcg tgttgacggc tctgatgtgc agtggctgcg cgactactga       360
//

If you have problems or comments...

PBIL Back to PBIL home page