(data stored in ACNUC1104 zone)

EMBL: CP002026.PE350

CP002026.PE350       Location/Qualifiers
FT   CDS_pept        351816..352280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0354"
FT                   /product="putative PTS IIA-like nitrogen-regulatory protein
FT                   PtsN"
FT                   /note="KEGG: azc:AZC_0344 PTS IIA-like nitrogen-regulatory
FT                   protein; TIGRFAM: PTS IIA-like nitrogen-regulatory protein
FT                   PtsN; PTS system, fructose subfamily, IIA subunit; PFAM:
FT                   phosphoenolpyruvate-dependent sugar phosphotransferase
FT                   system EIIA 2"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87687"
FT                   /db_xref="GOA:D7A2W9"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR006320"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:D7A2W9"
FT                   /inference="protein motif:TFAM:TIGR01419"
FT                   /protein_id="ADH87687.1"
FT                   /translation="MALNDILALSAIFPSLRVGSKKQALQELSAHAAQILKRDEREIFE
FT                   TLNQRERLGSTGVGSGIAIPHGKLAKMDKLFGMFARLEKPIDFEALDGEPVDLIFLLLA
FT                   PEAAGADHLKALARVARLLRDPEVAKKLRNSRDAAAIFTILTGTPATDAA"
     atggctctga acgatatttt ggcgctgtcc gcgatcttcc cgagcctgcg ggtcggcagc        60
     aagaagcagg cgctgcagga actctcggcc cacgccgcgc agatcctgaa acgggacgag       120
     cgggaaatct tcgagacgct gaaccagcgc gagcgcctcg gctccaccgg ggtgggcagc       180
     gggatcgcca tcccccacgg caagcttgcc aagatggaca agctgttcgg catgttcgcc       240
     cggctggaga agcccatcga cttcgaggcg ctggacggcg agccggtcga cctgatcttc       300
     ctcctgcttg cgccggaggc ggccggcgcc gaccatctca aggcgctggc gcgggtggcg       360
     cggctgctgc gcgaccccga ggtcgccaag aagctgcgca actcccgcga cgccgccgcg       420
     atcttcacca tactgaccgg cacgccggcc accgacgcgg cgtga                       465
//

If you have problems or comments...

PBIL Back to PBIL home page