(data stored in ACNUC1104 zone)

EMBL: CP002026.PE353

CP002026.PE353       Location/Qualifiers
FT   CDS_pept        complement(354117..354818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0357"
FT                   /product="ribosome biogenesis GTP-binding protein YsxC"
FT                   /note="KEGG: xau:Xaut_0361 ribosome biogenesis GTP-binding
FT                   protein YsxC; TIGRFAM: ribosome biogenesis GTP-binding
FT                   protein YsxC; PFAM: GTP-binding protein HSR1-related"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87690"
FT                   /db_xref="GOA:D7A2X2"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/TrEMBL:D7A2X2"
FT                   /inference="protein motif:TFAM:TIGR03598"
FT                   /protein_id="ADH87690.1"
FT                   /translation="MDTTAQDDDKPEAGGAAAAFSPEEIEAGRRLFAGEWNFLSAAPTI
FT                   PTMPPMRGIEIALAGRSNVGKSSLVNALTGRKALARTSVTPGRTQELIFFGLGPELTLV
FT                   DMPGYGFAKAPKDKVDAWTATIHAYLRGRANLARVFVLIDSRHGLKPIDTEVLDGLDKA
FT                   AVSYAIVLTKADQLKKGELAQRVEATQAALLRRPAAFPIVFPTSSREGWGIPELRAAVV
FT                   RLMAERGIAAG"
     gtggacacga ccgcgcagga cgacgacaag ccggaggcgg gcggcgcggc cgccgccttc        60
     tcgcccgagg agatcgaggc ggggcgccgg ttgttcgccg gcgagtggaa cttcctttcc       120
     gccgccccga cgattcccac catgccgccc atgcgcggca tcgagatcgc gctcgccggg       180
     cgctccaatg tcggcaagtc gagcctcgtc aacgcgctga cgggccgcaa ggcgctcgcc       240
     cgcacctcgg tgacgccggg gcgcacgcag gagctgatct tcttcggcct cgggccggag       300
     ctgaccctcg tcgacatgcc cggctacggc ttcgccaagg cgccgaagga caaggtcgac       360
     gcctggaccg ccaccatcca cgcctatctg cgcgggcgcg ccaacctcgc gcgcgtcttc       420
     gtgctgatcg attcccgcca tgggctgaag cccatcgaca ccgaggtgct ggacggcctg       480
     gacaaggccg cggtgtccta tgcgatcgtg ctgaccaagg ccgaccagct gaagaagggc       540
     gagctcgccc agcgggtgga agcgacgcag gcggcgctgc tgcgccggcc cgcggcgttc       600
     ccgatcgtct tcccgacctc cagccgcgag ggctggggca tccccgagct gcgcgccgcc       660
     gtggtgcggc tgatggccga gcgcggcatc gcggcgggct ga                          702
//

If you have problems or comments...

PBIL Back to PBIL home page