(data stored in ACNUC1104 zone)

EMBL: CP002026.PE354

CP002026.PE354       Location/Qualifiers
FT   CDS_pept        complement(354823..356652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0358"
FT                   /product="membrane protein insertase, YidC/Oxa1 family
FT                   domain containing protein"
FT                   /note="KEGG: xau:Xaut_1921 putative inner membrane protein
FT                   translocase component YidC; TIGRFAM: membrane protein
FT                   insertase, YidC/Oxa1 family domain containing; membrane
FT                   protein insertase, YidC/Oxa1 family; PFAM: 60 kDa inner
FT                   membrane insertion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87691"
FT                   /db_xref="GOA:D7A2X3"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR019998"
FT                   /db_xref="InterPro:IPR028053"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="InterPro:IPR038210"
FT                   /db_xref="InterPro:IPR038221"
FT                   /db_xref="UniProtKB/TrEMBL:D7A2X3"
FT                   /inference="protein motif:TFAM:TIGR03593"
FT                   /protein_id="ADH87691.1"
FT                   /translation="MTTENRNMIIAIVLSMAVLIAWQYFSGIPQMEQQRQQHAAQQQAA
FT                   QQQAAQPSGEAGTAAPAPGTSAPAPAGTAPKALTRAEALARSPRAVIDTPRVIGSVALK
FT                   GGRIDDLSLKDYRETVDPNSPIIVLLSPSGGPNPFYAEFGWVPGAGASVQVPNAETLWT
FT                   APEGAKLTHEAPLVLSWDNGAGLIFRRTLSIDANYMFHVVDEVENTTAAPVALHPYGLV
FT                   SRHGTPHVLGYYILHEGLIGVTSEAGLHEIKYKDIAERKTETFPSVGGWLGITDKYWAA
FT                   TVIPGIQEKVQARFSAAQAGNDFSYQTDFLGDAVSVAPGAKASTEGRLFAGAKEVRVVD
FT                   GYQSTYNIDRFDLLIDWGWFYFITKPLFLVIDWIYKGVGNFGVAILIVTVMLKIVFFPL
FT                   ANKSYASMAKMKAVQPEITALRERYGDDRVKLQQEMMEIYKKEKINPVAGCLPIVIQIP
FT                   VFFALYKVLFVTIEMRHAPFFGWIKDLSAPDPTTIFNLFGLIPWDPGQVPVIGHFLLLG
FT                   VWPIIMGITMWAQMKLNPAPPDPTQKAIFDWMPLIFTFMLGSFASGLVIYWAWNNTLSV
FT                   IQQSIIMRRNGVKIELWDNVKELFGRKKKPKAG"
     atgacgaccg aaaaccgcaa tatgatcatc gccatcgtgc tgtcgatggc ggtactgatc        60
     gcctggcagt acttctccgg catcccgcag atggagcagc agcgccagca gcacgcggcg       120
     cagcagcagg cggcacagca gcaagccgcc cagccctccg gcgaggccgg caccgcggca       180
     cccgcccccg gcacgagcgc gccggcaccg gccggcacgg cgcccaaggc gctgacccgc       240
     gccgaggccc tcgcccgctc gccccgcgcc gtcatcgaca cgccgcgcgt catcggctcg       300
     gtggcgctca agggcgggcg catcgacgac ctgtcgctga aggactaccg cgagaccgtc       360
     gaccccaaca gcccgatcat cgtgctgctc tcgccctcgg gcgggccgaa cccgttctat       420
     gccgaattcg gctgggtgcc gggcgccggc gcctccgtgc aggtgccgaa cgccgaaacg       480
     ctgtggaccg cccccgaggg cgccaagctc acccatgagg cgccgctggt gctgagctgg       540
     gacaacggcg ccggcctcat cttccgccgc accctctcca tcgacgccaa ctacatgttc       600
     catgtcgtgg acgaggtgga gaacacgacc gccgcaccgg tggcgctgca cccctatggg       660
     ctggtgtcgc gccacggcac gccgcatgtg ctcggctact acatcctgca cgagggcctg       720
     atcggggtga cctcggaagc gggcctgcac gagatcaagt acaaggacat cgccgagagg       780
     aagaccgaaa ccttcccgtc cgtcggcggc tggctcggca tcaccgacaa gtactgggcg       840
     gcgaccgtca tccccggcat ccaggagaag gtgcaggcgc gcttctccgc cgcgcaggcg       900
     ggtaacgact tctcctacca gaccgacttc ctcggcgacg cggtgagcgt ggcgccgggc       960
     gccaaggcct cgaccgaggg tcgcctgttc gccggcgcca aggaagtgcg cgtggtcgac      1020
     gggtatcaaa gcacctacaa catcgaccgc ttcgacctgc tgatcgactg gggctggttc      1080
     tatttcatca ccaagccgct cttcctggtg atcgactgga tctacaaggg tgtcggcaat      1140
     ttcggcgtcg ccatcctgat cgtcacggtg atgctgaaga tcgtcttctt cccgctcgcc      1200
     aataagagct acgcctcgat ggcgaagatg aaggcggtgc agccggagat cacggccctg      1260
     cgcgagcgct acggcgacga ccgcgtgaag ctccagcagg agatgatgga gatctacaag      1320
     aaggagaaga tcaacccggt cgcgggctgt cttcccatcg tgatccagat ccccgtcttc      1380
     ttcgcgctct acaaggtgct gttcgtcacc atcgagatgc ggcacgcgcc gttcttcggc      1440
     tggatcaagg acctctccgc gcccgatccg acgacgatct tcaacctgtt cggcctgatc      1500
     ccgtgggatc ccggccaggt gccggtcatc ggccacttcc tgctgctcgg cgtgtggccg      1560
     atcatcatgg gcatcaccat gtgggcccag atgaagctca acccggcccc gccggacccg      1620
     acgcagaagg cgatcttcga ctggatgccg ctgatcttca ccttcatgct cggctccttc      1680
     gcctcgggcc tcgtcatcta ctgggcgtgg aacaacacgc tctcggtgat ccagcagtcg      1740
     atcatcatgc gccgcaacgg cgtgaagatc gaactgtggg acaatgtgaa ggagctcttc      1800
     ggccgcaaga agaagccgaa ggccggctga                                       1830
//

If you have problems or comments...

PBIL Back to PBIL home page