(data stored in ACNUC1104 zone)

EMBL: CP002026.PE357

CP002026.PE357       Location/Qualifiers
FT   CDS_pept        357701..359269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0361"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: azc:AZC_4070 periplasmic sensor signal
FT                   transduction histidine kinase; PFAM: ATP-binding region
FT                   ATPase domain protein; histidine kinase HAMP region domain
FT                   protein; histidine kinase A domain protein; SMART:
FT                   ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87694"
FT                   /db_xref="GOA:D7A2X6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D7A2X6"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADH87694.1"
FT                   /translation="MKKRSGAGSQAIALPAAAAGFGELRLHAGTPQVTAETAAATSPKP
FT                   PRHLGLSGKLLAFTLAFVLLAEVLILVPAVAAFRLNWLSDRLAGARTAALVLDAAPDGM
FT                   ISPQLTQELLRSVGAITVALKRDDTRRLLASTDMPPEVDHHADVRDVGPWQAVSEAFDT
FT                   LLARDGRVIRAVGTPPRGDGFVEIVIDETPLRKAMLRFTGNLLLVSLVIAALTGALVYL
FT                   GLAWMFVRPMRRLTQRMVAFRADPSHPVPEVETDGRMDEIGQAERELTAMQQQIAETLQ
FT                   QKSHLAALGLAVSKINHDLRNLLASVQLISDRLADIRDPAVQRFAPKLEVALDRAIAYC
FT                   EHTLAYGKAQEPAPERRMVPLAPLVAEVRDTLGLGPDEAQGIGFVESVDRELEVDADPD
FT                   QLFRVLLNLCRNAVEALSARSPNEPSRDQIRITGRREGAIVIIEVADTGPGVPERARAH
FT                   LFEAFQGSARRGGTGLGLAIAAELMHAHGGDIQLVPGTIGATFQLRVPDRPVDLEAHRA
FT                   LRQHG"
     atgaagaagc gttcgggagc cgggagtcag gccatcgcct tgcccgccgc cgcggcgggg        60
     ttcggcgaac tgcgcctgca tgccggtact ccgcaggtga cggccgagac ggccgccgcc       120
     acctcgccga agccgccgcg ccatctcggc ctctccggca agctgctcgc cttcaccctc       180
     gccttcgtgc tgctggccga ggtgctgatc ctcgtgccgg cggtcgccgc cttccgcctc       240
     aactggctgt ccgaccggct cgccggcgcc cgcaccgccg ccctcgtgct cgacgcggcg       300
     ccggacggca tgatctcgcc gcagctgacc caggaattgc tgcgcagcgt cggcgccatc       360
     accgtcgccc tgaagcgcga cgacacgcgc cgcctgctcg cctcgaccga catgccgccg       420
     gaggtcgacc accatgccga cgtgcgcgac gtcggcccct ggcaggcggt gtcggaagct       480
     ttcgacacgc tgctcgcccg cgacggacgc gtgatccgcg ccgtcggcac gccgccgcgc       540
     ggcgacggct tcgtcgagat cgtcatcgac gagacgccgc tgcgcaaggc gatgctgcgc       600
     ttcaccggca acctgctgct ggtctcgctg gtgatcgccg cgctgaccgg cgcgctggtc       660
     tatctcggcc tcgcctggat gttcgtgcgg ccgatgcgcc ggctcaccca gcgcatggtg       720
     gccttccgcg ccgacccctc gcatccggtg cccgaggtcg agacggatgg ccgcatggat       780
     gagatcggcc aggccgagcg cgagctcacc gccatgcagc agcagatcgc cgagacgttg       840
     cagcagaaga gccatctcgc cgccctcggc ctcgccgtct ccaagatcaa ccacgatctg       900
     cgcaacctgc tcgcctcggt gcagctgatc tccgaccgcc tcgccgacat acgtgacccg       960
     gcggtacagc gattcgcgcc caagctggag gtcgcgctcg accgcgccat cgcctattgc      1020
     gagcacacgc tggcctatgg aaaggcgcag gagccggcgc cggagcggcg catggtgccg      1080
     ctcgcgccgc tggtcgccga ggtgcgcgac acgctcggcc tcggccccga cgaggcgcag      1140
     gggataggct tcgtcgaatc ggtcgaccgc gagctggagg tcgatgccga cccggaccag      1200
     ctgttccgcg tgttgctgaa cctctgccgc aacgcggtcg aggcgctttc cgcccggtcg      1260
     ccgaacgaac cctcgcgcga ccagatccgc atcaccggcc ggcgcgaggg cgccatcgtc      1320
     atcatcgagg tggccgatac cggccccggc gtgcccgagc gcgcccgcgc gcacctgttc      1380
     gaggccttcc agggctcggc gcggcgcggc ggcaccgggc tcggcctcgc catcgccgcc      1440
     gagctgatgc acgcgcatgg cggcgacatc cagctcgtgc ccggcaccat cggcgccacc      1500
     ttccagctgc gcgtgcccga ccggcccgtc gacctcgagg cgcaccgtgc cctgcgccag      1560
     catggctga                                                              1569
//

If you have problems or comments...

PBIL Back to PBIL home page