(data stored in ACNUC1104 zone)

EMBL: CP002026.PE358

CP002026.PE358       Location/Qualifiers
FT   CDS_pept        359247..360533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0362"
FT                   /product="glycosyl hydrolase family 2 protein"
FT                   /note="KEGG: azc:AZC_0891 glycosyl hydrolase family 2
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87695"
FT                   /db_xref="GOA:D7A2X7"
FT                   /db_xref="InterPro:IPR006103"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D7A2X7"
FT                   /inference="similar to AA sequence:KEGG:AZC_0891"
FT                   /protein_id="ADH87695.1"
FT                   /translation="MPCASMAERKGEGRGRGRWFWAGLILLATIHAAVAADVTVSGRQI
FT                   LNDGKRFDVRGATGDGPLPMLATLGATTVRTYGEDPGPILDAAEKAGLKVIVGLWVGQP
FT                   RQGADYGDRAFVERQLAELQAMVEKYRNHPALLMWGIGNEVEVELADDSPAWPAIEQVA
FT                   AMVRRVDPAHPTMGVLAETGSDKVKKLIAQAPSIQVLGLNSYGDALYSAASRARAQGWE
FT                   GPIVVTELGALGQWQAAQAPWGAPFEPSSTQKAIQLRRYLKALEGEEVGTIAFLWGSKQ
FT                   EVTPTWHSLLLPDGVWLEASEAMAEAWGGQAPAENHAPRIGYLRVADDPSAPFAVWPAG
FT                   DEGSFTLDAVDPDGDMLEARWSVMAESAARSVGGDPEAAPHAFPEAVRQSGPTGARISG
FT                   LPAGRYRVFVEVHDGRGAAATANMPFEVR"
     gtgccctgcg ccagcatggc tgagcgcaag ggggagggca gggggagagg gcgctggttc        60
     tgggccggcc tcatcctcct tgccaccatt cacgccgcgg tggcggcgga tgtcaccgtt       120
     tctggccggc agatattgaa cgacggcaag cgtttcgacg tgcgcggcgc caccggtgac       180
     ggcccgctgc ccatgctcgc caccctcggc gccaccaccg tgcgtaccta tggcgaggat       240
     cccggcccga tcctcgatgc ggcggagaag gccgggctga aggtgatcgt cggcctgtgg       300
     gtcggccagc cgcggcaggg cgccgattat ggcgaccgcg ccttcgtcga gcggcagctc       360
     gccgaactgc aggccatggt ggagaaatac aggaaccacc cggcgctgct gatgtggggc       420
     atcggcaacg aggtcgaggt cgaactcgcc gacgactccc ccgcatggcc ggcgatagag       480
     caggtggcgg cgatggtgcg ccgcgtcgat ccggcccatc cgacgatggg cgtgctggcg       540
     gagaccggca gcgacaaggt gaagaagctg atcgctcagg cgcccagtat ccaggtgctc       600
     gggctcaact cttatggcga cgcgctctat tccgccgcct cccgcgcccg cgcgcagggc       660
     tgggaaggac ccatcgtcgt caccgagctg ggcgcgctcg gccaatggca ggccgcgcag       720
     gccccgtggg gcgcgccctt cgagccgagc tcgacgcaga aggcgatcca gctgcgccgc       780
     tacctcaagg cgctggaggg cgaggaggtc gggaccatcg ccttcctctg gggctcgaag       840
     caggaggtga cgccgacctg gcacagcctg ctgctgccgg atggcgtgtg gctggaggcc       900
     tccgaagcca tggccgaagc ctggggcggg caggcgccgg cggagaatca cgcgccccgc       960
     atcggttatc tgcgggtggc cgacgacccc agcgcgccct tcgccgtgtg gccggcgggc      1020
     gacgagggct ccttcaccct cgacgcggtg gatccggatg gcgacatgct ggaggcgcgt      1080
     tggtcggtga tggcggagag cgccgcgcgc agcgtcggcg gcgatccgga ggccgcgccc      1140
     cacgccttcc ccgaggcggt gcgccagagc gggccgaccg gcgcgcgcat ctccggcttg      1200
     ccggcgggcc gctaccgcgt cttcgtcgag gtgcatgacg gccgcggcgc ggcggcgacg      1260
     gcgaatatgc cgttcgaggt gcggtag                                          1287
//

If you have problems or comments...

PBIL Back to PBIL home page