(data stored in ACNUC1104 zone)

EMBL: CP002026.PE359

CP002026.PE359       Location/Qualifiers
FT   CDS_pept        complement(361273..362031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0363"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   bpy:Bphyt_6213 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87696"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7A2X8"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADH87696.1"
FT                   /translation="MTENRELAGHTALVTGAARNVGRAIAVALARAGARVVVHARSSVD
FT                   AANETVAQCQQAFGGADGAFAHFADLTDPEAVRIMFAEVEARFGGLDLLVHNAAERADG
FT                   PFDEISFAEWRRIVGSILDSAFLCDQAALPLLRRSAAASIIHIGGVAAHVGVRHRAHVS
FT                   AAKAGIVGLTRALAAEFASEQITVNCISPAQMETERKGHMPEHFRQRPVPLGRPGQPAE
FT                   LASLVCFLAGPSGRFITGQTIHLNGGWYMG"
     atgacggaga atcgggaact tgccggccat acggcgctgg tgaccggagc ggcccgcaac        60
     gtcgggcgtg ccatcgccgt ggctctggca cgagccggcg cgagggtggt ggtgcatgcg       120
     cgctcctcgg tggacgcggc gaacgagacc gtcgcgcagt gccagcaagc gttcggcggc       180
     gcggacgggg ctttcgcgca ctttgccgat ctgaccgacc cggaagccgt gcggatcatg       240
     ttcgcggagg tcgaagcgcg cttcggcggg ctcgatctcc tggttcacaa cgccgccgaa       300
     cgtgcggacg gccccttcga cgagatcagc tttgccgaat ggcgccgcat cgtcggcagc       360
     atcctcgaca gtgctttcct gtgcgaccag gcggccctgc cgctgctgag gcgcagcgcc       420
     gccgccagca tcatccatat cggcggcgtc gccgcgcatg tgggcgttcg ccatcgcgcc       480
     cacgtctcgg cggcgaaggc cgggatcgtc ggcctcacgc gggcgcttgc cgccgagttc       540
     gcgtccgaac agatcacggt gaactgcatc tcgccggccc agatggagac cgagcgcaag       600
     gggcacatgc ccgagcattt ccggcagcgc ccggtgccgc tcggccgtcc gggacagccc       660
     gccgaactcg ccagcctcgt ctgcttcctt gccggccctt ccggccgctt catcaccggc       720
     cagaccatcc atctcaacgg cgggtggtac atgggatga                              759
//

If you have problems or comments...

PBIL Back to PBIL home page