(data stored in ACNUC1104 zone)

EMBL: CP002026.PE361

CP002026.PE361       Location/Qualifiers
FT   CDS_pept        363006..363227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0365"
FT                   /product="biotin/lipoyl attachment domain-containing
FT                   protein"
FT                   /note="PFAM: biotin/lipoyl attachment domain-containing
FT                   protein; KEGG: pla:Plav_2982 biotin/lipoyl attachment
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87698"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:D7A2Y0"
FT                   /inference="protein motif:PFAM:PF00364"
FT                   /protein_id="ADH87698.1"
FT                   /translation="MAKVDIKTEITGNVWKIEKAVGEQVGEEDVILILESMKMEIPVSA
FT                   PEDGVIIEILVAEGDTVTEGTVVARIEA"
     atggcaaagg tcgacatcaa aacagaaatc acgggcaacg tctggaagat cgagaaagcg        60
     gtcggcgagc aggtcggcga ggaggatgtg atcctcatcc tcgagtcgat gaagatggag       120
     atccccgtct cggcgccgga ggacggtgtg atcatcgaaa tcctcgttgc cgaaggtgac       180
     accgtgaccg agggcaccgt cgttgcccgc atcgaggcct ga                          222
//

If you have problems or comments...

PBIL Back to PBIL home page