(data stored in ACNUC1104 zone)

EMBL: CP002026.PE365

CP002026.PE365       Location/Qualifiers
FT   CDS_pept        complement(367764..369299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0369"
FT                   /product="carboxyl transferase"
FT                   /note="PFAM: carboxyl transferase; KEGG: bbr:BB2690
FT                   putative carboxyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87702"
FT                   /db_xref="GOA:D7A2Y4"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:D7A2Y4"
FT                   /inference="protein motif:PFAM:PF01039"
FT                   /protein_id="ADH87702.1"
FT                   /translation="MPHDVMLEKLDERRTQARRMGGLDKLAKRAERGQLNAKERLDALV
FT                   DPGSFFEVGLLGASGVFDADVEATPRDGKITGFGRIEARDVGVVVNDFTTKGASTSATN
FT                   SKKMGYIRRTCTERGMPFLHIGESTGARLPDAMGSKGMGALLGNDTTQFKRMRDTPWVA
FT                   AALDTSFGSSAWLCCCADFAVMKKGSIMSVSSPRLVSMAIGEKVDLEELGGWRLHAEQT
FT                   GLIDYFVDTDAEAMAVIRQFLSYMPSHNGELAPNAPVTEGSGEDQDRILAVLPEKRTQV
FT                   YNMKKIIEVIFDRDSFFEVKARFGKSAVVGLARLNGQAVGVVANNPQVGGGALSAEACR
FT                   KIIDLTVLCDSFNLPIVRLVDTPGFVVGTEAERRGAPGHIMNFMNATCLTTVPSVTVLC
FT                   RKAYGRAYVAMGGGAHNDAMIAWPTAEVSFMDPVFATSIVHNLTAGQEGFEDALAHIQK
FT                   DLEIWDMARIFSAQDVVKPQETRAWVIRMLDIQRRRRSGGLGQHLMRTWPTSY"
     atgcctcacg acgtaatgct cgagaaactc gacgagcgcc gcacgcaggc gcggcgcatg        60
     ggtgggctgg ataaactggc caagcgcgcc gagcgcggcc agctcaatgc caaggagcgg       120
     ctggacgctc tcgtcgaccc cggcagcttc ttcgaggtcg ggctgctcgg cgcttccggc       180
     gtgttcgacg ccgatgtcga ggcgacgccc cgcgacggca agatcaccgg cttcggcagg       240
     atcgaggcgc gggacgtcgg cgtggtggtg aacgacttca ccaccaaggg cgcctccacc       300
     agcgccacca actcgaagaa gatgggctat atccgtcgca cctgcaccga gcggggcatg       360
     cccttcctcc atatcggaga gtccaccggc gcgcgccttc ccgacgccat gggttctaag       420
     ggcatgggag cgctgctcgg caacgacacc acccagttca agcgcatgcg ggacacgccg       480
     tgggtcgcgg ccgcgctcga cacctccttc ggctcgtccg cctggctttg ctgctgcgcc       540
     gacttcgcgg tgatgaagaa gggctcgatc atgtcggtgt cgagcccgcg cctcgtgtcc       600
     atggccatcg gcgagaaggt cgacctcgaa gagctcggcg gctggcggct gcatgccgag       660
     cagaccggcc tcatcgacta tttcgtcgac accgatgccg aggcgatggc ggtgatccgc       720
     cagttcctct cctacatgcc gagccacaat ggcgagctcg cacctaatgc gcccgtcacc       780
     gagggatcgg gcgaggatca ggaccgcatc ctcgccgtgc tgccggagaa gcgcacgcaa       840
     gtctacaaca tgaagaagat catcgaggtg atcttcgatc gcgacagctt cttcgaggtc       900
     aaggcccgct tcggcaagtc ggcggtggtg ggtcttgccc ggctcaacgg gcaggcggtg       960
     ggcgtcgtcg ccaacaaccc ccaggtcggc ggcggggcgc tctcggcgga agcctgccgc      1020
     aagatcatcg acctcaccgt gctgtgcgac agcttcaacc tgccgatcgt gcgcctcgtc      1080
     gacacgcccg gcttcgtcgt cggcaccgag gccgagcggc gcggcgcgcc gggccacatc      1140
     atgaacttca tgaacgccac ctgcctgacc acggtgccct cggtcaccgt gctgtgccgc      1200
     aaggcctatg ggcgcgccta tgtcgcgatg ggcggcggcg cccacaacga cgcgatgatt      1260
     gcctggccga ccgccgaagt gagcttcatg gacccggtgt tcgccaccag catcgtccac      1320
     aatctcaccg ccgggcagga gggcttcgag gacgcgctgg cgcatatcca gaaggacctc      1380
     gaaatctggg acatggcccg catcttctcc gcgcaggacg tggtgaagcc ccaggagacc      1440
     cgcgcctggg tcatccgcat gctggacatc cagcgtcgcc ggcgctcggg cggcctgggc      1500
     cagcacctga tgcgcacctg gccgacgagc tattga                                1536
//

If you have problems or comments...

PBIL Back to PBIL home page