(data stored in ACNUC1104 zone)

EMBL: CP002026.PE368

CP002026.PE368       Location/Qualifiers
FT   CDS_pept        371906..372409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0372"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xau:Xaut_1331 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87705"
FT                   /db_xref="GOA:D7A2Y7"
FT                   /db_xref="InterPro:IPR009936"
FT                   /db_xref="UniProtKB/TrEMBL:D7A2Y7"
FT                   /inference="similar to AA sequence:KEGG:Xaut_1331"
FT                   /protein_id="ADH87705.1"
FT                   /translation="MATQHDEPTVDVSAEPKDLSFRLELGDALAGAALLAFAVTFWVLG
FT                   ADIDDGGGYGVGAATFPRGIALLLGIGALVLLANGLVHLFGPPSGHLVTIGRPLHVIAG
FT                   MGLMLAFAPAMRHLGYYPTMGVFLAALLWVADCRRPLHILAYVAGFLLFSKVVFEMVLS
FT                   IPLP"
     atggcaactc aacacgacga gccgaccgtc gacgtctccg ccgagcccaa ggatctcagc        60
     ttccgcctgg aactgggaga cgcccttgcc ggggccgcgc tcctggcgtt cgccgtcacg       120
     ttctgggtgc tcggcgccga catcgatgac ggcggcggct atggcgtcgg cgccgcgacc       180
     ttcccgcgcg gcatcgcgct gttgctcggc atcggcgcct tggtgcttct ggccaacggc       240
     ctcgtgcatc tgttcggtcc gccgagcggg catctggtga ccatcggccg gccgctgcat       300
     gtcatagcgg gcatgggcct gatgctggcc ttcgcgccgg ccatgcggca cctcggctac       360
     tacccgacca tgggcgtctt cctcgcggcc ctgctctggg tcgccgattg ccgtcgcccc       420
     ctgcacatcc tcgcctatgt cgcgggcttc ctgctgttca gcaaggtcgt cttcgagatg       480
     gtcctctcca tcccactgcc ctga                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page