(data stored in ACNUC1104 zone)

EMBL: CP002026.PE37

CP002026.PE37        Location/Qualifiers
FT   CDS_pept        28415..28699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0037"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bbt:BBta_5763 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87374"
FT                   /db_xref="GOA:D6ZZW0"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZW0"
FT                   /inference="similar to AA sequence:KEGG:BBta_5763"
FT                   /protein_id="ADH87374.1"
FT                   /translation="MRNEPNKSVVLSISRDELREEMEKAVRRGLEDVGLYTEDAEDRRE
FT                   TREDMRFVRRLRRATDGIAAKVGYTVLAIVTGGFLVVIWAGIKVHVLKQ"
     atgcggaatg agcccaacaa atctgtcgtc ctctccatct cgcgcgacga gctgcgcgag        60
     gaaatggaga aggccgtgcg tcgcggcctc gaggatgtcg ggctctacac tgaggatgct       120
     gaggaccggc gtgagacgcg cgaggatatg aggtttgtgc gccggcttcg ccgggcgacc       180
     gacggcatcg cggccaaggt cggctacacc gtgctcgcca tcgtgaccgg cggcttcctg       240
     gtggtcatct gggccggcat caaggtccat gtgctcaagc aatga                       285
//

If you have problems or comments...

PBIL Back to PBIL home page