(data stored in ACNUC1104 zone)

EMBL: CP002026.PE371

CP002026.PE371       Location/Qualifiers
FT   CDS_pept        375025..375957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0375"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="KEGG: bja:blr4463 ABC transporter substrate-binding
FT                   protein; PFAM: extracellular solute-binding protein family
FT                   3; SMART: extracellular solute-binding protein family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87708"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:D7A2Z0"
FT                   /inference="protein motif:PFAM:PF00497"
FT                   /protein_id="ADH87708.1"
FT                   /translation="MALDLDTHSRAKGGPMGARLRSALLGVLGLALATGGLATALPQQA
FT                   EASMPAACAALQAKYPSLKGKTLINAINPHTPGYETIDPADPTKYIGFDIDLGEAIGEC
FT                   LGFKLTYKPVTFAALLTTLQAEQADIVISDIYATKERAKAADFITYLKVFDGVLVAKGN
FT                   PKGIDGINLSLCGAVAAENTGYVEVPLIQALEAECKKAGKPAPEILLFDNNANCIQAIL
FT                   AGRADTYINDVNTVDGAVKAYPDKLAKATAVTLPYSVGIAVPRNKVEFRDAVMAALTEI
FT                   QKSGLQAELMKKWNLPAEQLESPKLVLAD"
     gtggcactcg atctcgacac gcattcccgt gcgaaaggcg gcccgatggg cgcgcggctg        60
     cgctcggcgc tccttggcgt tctgggcctc gcactcgcca ccggcgggct cgcgaccgcc       120
     ctgccgcagc aggccgaagc ctccatgccg gccgcctgcg ccgcgcttca ggcgaaatat       180
     ccctcgctga agggcaagac cctcatcaac gccatcaacc cgcacacgcc gggctacgag       240
     accatcgatc ccgccgaccc gaccaagtat atcggcttcg acatcgatct cggcgaggcc       300
     atcggggaat gcctcggctt caagctgacc tacaagccgg tcaccttcgc tgcgctgctg       360
     accacgctgc aggcggaaca ggccgacatc gtcatctccg acatctacgc caccaaggag       420
     cgcgccaagg ccgcggactt catcacctat ctcaaggtgt tcgacggcgt gctggtcgcc       480
     aagggcaatc cgaagggcat cgacggcatc aacctgtccc tgtgcggcgc ggtggccgcc       540
     gagaacaccg gctatgtcga ggtgccgctg atccaggcgc tggaggccga gtgcaagaag       600
     gcgggcaagc cggcgcccga aatcctgctc ttcgacaaca acgccaattg catccaggcg       660
     atcctggccg ggcgcgccga cacctacatc aatgacgtca acacggtgga cggcgccgtg       720
     aaggcctatc cggacaagtt ggcgaaggcg acggcggtga cgctgcccta ttcggtgggc       780
     atcgccgtgc cacgcaacaa ggtcgagttc cgcgacgcgg tcatggctgc gctgaccgag       840
     atccagaagt ccggcctgca ggccgagctg atgaagaagt ggaacctgcc cgccgagcag       900
     ctggaaagcc cgaagctcgt cctcgccgac tga                                    933
//

If you have problems or comments...

PBIL Back to PBIL home page