(data stored in ACNUC1104 zone)

EMBL: CP002026.PE372

CP002026.PE372       Location/Qualifiers
FT   CDS_pept        376040..377665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0376"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: ABC transporter related;
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; KEGG: bbt:BBta_6505 ABC transporter
FT                   permease/ATP-binding protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87709"
FT                   /db_xref="GOA:D7A2Z1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7A2Z1"
FT                   /inference="protein motif:TFAM:TIGR01726"
FT                   /protein_id="ADH87709.1"
FT                   /translation="MDLFLHYLSMPYLIDGVGYTLLITVLGLLGGLLMGVVLAAMQLSR
FT                   FRALAIIARGYSIIFRGTPLILQMVFCYNALPLIGIKLTAISAAGLALALNEAPFIAEI
FT                   LRSNVIGVDRGQVSAGQALGMTPAAIMRRVIAPQAIRSMVPALGNEAVSALKNSSLASV
FT                   VAVQELTLRSTQLASATFDFFSIFFASGLMYLILTGAIAVIQIVVEMLLDLDRPPPKEQ
FT                   LRRFLRAMLPGRAEPVPADAAGAVPPDVAKEILEEIAVDPLPPASPKAALARPDREARA
FT                   RRLAGNNVAVEVKGLRKRYGDQTVLDGIDLTVRAGEVVALLGPSGSGKSTLLRCINRLE
FT                   GWEDGTIRVGGRFLGSDEAGRPLSPRTTAQMRASVGVGMVFQQFNLFGHLTAEENIAGP
FT                   LRWVQGLSRLDARRRAQELLERVGLAHRADALPRHLSGGQQQRVAIARAVAPGPSVLLL
FT                   DEPTSALDPELVGEVLEVIRRLAVEDGLAMIISTHQLHFAGDVADRIVFLAGGSIVEEG
FT                   PAQQVLREPRHPLTARFLSTMAAD"
     atggatctct tcctgcatta tctgagcatg ccgtacctga tcgacggcgt gggctacacg        60
     ctgctgatca cggtgctggg gctcctcggc gggctcctga tgggcgtggt gctcgcggcg       120
     atgcagctca gccgcttccg ggcgctcgcc atcattgccc gaggctattc gatcatcttc       180
     cgcggcacgc cgctgatcct gcagatggtg ttctgctaca acgccctgcc gctgatcggc       240
     atcaagctca ctgcgatctc cgccgcgggg ctcgcgctgg cgctcaacga ggcgcccttc       300
     atcgccgaga tcctgcgctc caacgtcata ggtgtcgacc ggggccaggt gagtgccggc       360
     caggcgctcg gcatgacgcc ggccgccatc atgcgccggg tgatcgcgcc gcaggccatc       420
     cgttccatgg tgcccgcgct cggcaacgag gcggtgagcg cgctgaagaa ctcgtcgctc       480
     gcgtcggtcg tggcggtgca ggagctcacc ctgcgttcga cccagctcgc ctcggcgacc       540
     ttcgacttct tctccatctt cttcgcctcg gggctgatgt acctgatcct caccggggcc       600
     atcgcggtga tccagatcgt ggtcgagatg ctgctcgacc tcgaccgtcc gccgcccaag       660
     gaacagttgc gacgatttct gcgggcgatg ctgccgggcc gcgccgaacc ggtgccggca       720
     gacgccgccg gtgccgtccc gcccgacgtc gcgaaggaaa tccttgaaga aatcgccgtc       780
     gatccgctgc cgccggcatc gccgaaggcc gcgctggcgc ggccggatcg ggaggcccgc       840
     gcccgccgcc ttgccggcaa taacgttgcg gtcgaggtga aggggctgcg caagcgctat       900
     ggcgaccaga ccgtgctcga cggcatcgac ctgacagtgc gcgccggcga ggtcgtcgcg       960
     cttctcggcc cgagcggctc gggcaagtcg acgctgctgc gctgcatcaa ccggctggaa      1020
     ggctgggagg acggcaccat ccgcgtcggc ggccgcttcc tcggcagcga cgaggcggga      1080
     cgcccgctct caccgcgaac gaccgcgcag atgcgcgcca gcgtcggcgt cggcatggtg      1140
     ttccagcagt tcaacctgtt cggccacctg accgcggagg agaacatcgc cgggccgctg      1200
     cgctgggtgc aggggctgtc gcggctcgat gcccgccgtc gggcgcagga actgcttgaa      1260
     cgcgtcggcc ttgcccaccg cgccgatgcg ctgccgcgcc atctctctgg cggccagcag      1320
     cagcgcgtcg ccatcgcccg cgccgtggcg cccggtccca gcgtgctgct gctcgacgag      1380
     ccgacctcgg cgctcgatcc cgaactcgtg ggcgaggtgc tggaggtgat ccgccgcctc      1440
     gcggtggagg acgggctcgc catgatcatc tccacccacc agctgcattt cgcaggcgat      1500
     gtggccgacc ggatcgtctt cctcgccggc ggctcgatcg tcgaggaggg cccggcccag      1560
     caggttctgc gcgagccgcg ccatccgctc accgcccgct tcctcagcac catggccgcc      1620
     gattga                                                                 1626
//

If you have problems or comments...

PBIL Back to PBIL home page