(data stored in ACNUC1104 zone)

EMBL: CP002026.PE373

CP002026.PE373       Location/Qualifiers
FT   CDS_pept        377733..378971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0377"
FT                   /product="Acetamidase/Formamidase"
FT                   /note="PFAM: Acetamidase/Formamidase; KEGG: bra:BRADO1537
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87710"
FT                   /db_xref="GOA:D7A2Z2"
FT                   /db_xref="InterPro:IPR004304"
FT                   /db_xref="UniProtKB/TrEMBL:D7A2Z2"
FT                   /inference="protein motif:PFAM:PF03069"
FT                   /protein_id="ADH87710.1"
FT                   /translation="MTKHHLPATPDTVHWGYFSRTLDPVLTLKSGERAVIETITHHAND
FT                   DYERMIAGDRAAEEIFLWTKEAKTLRRRGAGATEGPFTYGSGEGLGVHLLTGPIAVEGA
FT                   EPGDVIEVRIIDAWPRPSANPAYQGRFFGSNPSANWGFQYKDLIEEPKPREVVTIYELD
FT                   MGEAAVKALYSYRWTPQTDPDGIVHPTIDYPGVRVDHGTIVKKEGILPGIKVPARLHFG
FT                   TMGLAPAEADFVSTIPPNYTGGNMDDWRIAKGARMYYPVAVPGGLFSCGDAHASQGDSE
FT                   LSGTAIEISLTGEFEFILHKKEQLDGTLLEGLNHPLLENDELWSVYGFSVANYLTELGP
FT                   DHQTEILKRGSLDNAMRDAFRKLRRFLMTTQKLSEDEAISLMSVAADFAVTQVVDANWG
FT                   LTGSIRKSIFAGR"
     atgaccaagc accatctgcc cgccactcct gacaccgtcc attggggcta tttcagccgg        60
     accctcgacc cggtgctgac gctcaagtcc ggcgagcggg cggtgatcga gaccatcacc       120
     caccacgcca atgacgatta cgagcgcatg atcgccggcg accgggcggc ggaggagata       180
     ttcctctgga ccaaagaggc gaagaccctg cgccgccgcg gggcgggcgc gaccgagggg       240
     ccgttcacct atggctcggg cgaggggctc ggcgtgcatc tgctcaccgg cccgatcgcg       300
     gtcgagggag cagagccggg cgacgtgatc gaggtgcgca tcatcgacgc ctggccccgc       360
     ccgagcgcca atcctgccta tcagggccgg ttcttcggct ccaacccgtc cgccaactgg       420
     ggcttccagt acaaggacct gatcgaggag ccgaagcccc gcgaggtcgt caccatctac       480
     gagctcgaca tgggcgaagc cgcggtgaag gcgctctatt cctaccggtg gacgccgcag       540
     accgatccgg acggcatcgt gcacccgacc atcgactatc cgggcgtgcg ggtcgaccac       600
     ggcaccatcg tgaagaagga gggcatcctg ccgggcatca aggtgccggc gcggctgcat       660
     ttcggcacga tgggccttgc cccggccgag gcggatttcg tctccaccat cccgccgaac       720
     tacaccggcg gcaacatgga cgactggcgc atcgccaagg gcgcacggat gtactacccg       780
     gtagccgtgc ccggcggcct gttctcctgc ggcgacgccc atgcctcgca gggcgacagc       840
     gagctctccg gcaccgcgat cgagatttcg ctcaccggcg agttcgagtt catcctgcac       900
     aagaaggagc agctggacgg cacgctgctc gaggggctga accacccatt gctggagaac       960
     gacgagctct ggtcggtcta cggcttcagc gtcgccaact atctgaccga gctgggcccg      1020
     gaccaccaga cggagatcct gaagcgcggc agcctcgaca acgcgatgcg cgacgccttc      1080
     cgcaagctgc gccgcttcct catgaccacg cagaagctct ccgaggacga ggcgatctcg      1140
     ctgatgtcgg tggccgcgga cttcgcggtg acgcaggtgg tggacgccaa ttggggcctc      1200
     accggctcga tccgcaagag catcttcgcc ggccgctga                             1239
//

If you have problems or comments...

PBIL Back to PBIL home page