(data stored in ACNUC1104 zone)

EMBL: CP002026.PE380

CP002026.PE380       Location/Qualifiers
FT   CDS_pept        complement(386230..386946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0384"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="KEGG: bxe:Bxe_A2433 polar amino acid ABC transporter
FT                   inner membrane protein; TIGRFAM: polar amino acid ABC
FT                   transporter, inner membrane subunit; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87717"
FT                   /db_xref="GOA:D7A2Z9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7A2Z9"
FT                   /inference="protein motif:TFAM:TIGR01726"
FT                   /protein_id="ADH87717.1"
FT                   /translation="MFGLDYSWLSDPVYQDWLLRGTLTTIGLALASSAIAILIGAFGAL
FT                   ALSLRIAWLDALIELFVELFRNTPPLLQMLFFYFTLSTIGLRVTDPATGLSVPLLSAFD
FT                   CALVSLSLFGGALCIEAFRSGLESLPHSVTEAARSLGYSRWARFRRIEMPIASRICLPA
FT                   LTNILTNLFKTTSQASVITVPELMYYAGQIYNDTFRTAEVMLLVLLIYVSLVSLLSWGM
FT                   SRIEQALAFPGYGKGH"
     ttgttcggtc tcgactattc ctggctgagc gacccggtct atcaggactg gctgcttcgc        60
     gggacgctca ccaccatcgg actggcgctc gcctcctcgg cgatcgccat cctcatcggc       120
     gcgttcgggg cgctggcgct gagcctgcgc atcgcctggc tcgacgcgct gatcgagctc       180
     ttcgtcgaat tgttccgcaa cactccgccg ctgctgcaga tgctgttctt ctacttcacg       240
     ctcagcacca tcgggctgcg cgtgaccgac ccggcgacgg ggctgagcgt gccgctgctc       300
     tcggccttcg actgcgccct ggtttcgctg agcctgttcg gcggcgcgct gtgcatcgag       360
     gccttccgtt ccggactgga gagcctgccg cactcggtca ccgaggcggc gcgctcgctc       420
     ggctacagcc gctgggcccg cttccggcgc atcgagatgc cgatcgccag ccgcatctgc       480
     ctgccggcgc tcaccaatat cctgaccaac ctgttcaaga ccacctcgca ggcctcggtc       540
     atcacggtcc cggagctgat gtactacgcc ggccagatct acaacgacac gttccgcacc       600
     gccgaggtca tgctgctggt gttgctgatc tacgtgtcgc tggtgagcct tctgtcctgg       660
     ggcatgtcgc gcatcgagca ggcgctcgcc ttccccggct acggcaaggg ccactga          717
//

If you have problems or comments...

PBIL Back to PBIL home page