(data stored in ACNUC1104 zone)

EMBL: CP002026.PE381

CP002026.PE381       Location/Qualifiers
FT   CDS_pept        complement(386972..387796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0385"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="KEGG: bxe:Bxe_A2434 polar amino acid ABC transporter
FT                   periplasmic ligand-binding protein; PFAM: extracellular
FT                   solute-binding protein family 3; SMART: extracellular
FT                   solute-binding protein family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87718"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:D7A300"
FT                   /inference="protein motif:PFAM:PF00497"
FT                   /protein_id="ADH87718.1"
FT                   /translation="MRTSILTIAASLAMTLGIGAASADTLADVKAKGTLTIGVKNDYPP
FT                   YGFLNDKGEIVGFEVDLGKYIAKELLGPEGKFELVPVVAANRIEFLNSGRIDIILATLG
FT                   VTEERGKVIDFSEYYVSAPGPSVIAPKAATFSKWEELKGLTLCGIQGSYYNKHLSGDLG
FT                   IQLTAFKTQPEAYRALKDNRCVGFVFDDMTLRQKTEEADWAGYKIAVDPYEYIPQAAGI
FT                   RKNDVAFRDAVNKAITKAEAEGKLIEWETTYGMPPAKYIAERAKAAAAKLKP"
     gtgagaactt ccatcctgac catcgccgcc tcgctcgcga tgacgctggg catcggtgcg        60
     gcgagcgccg acacgctcgc cgacgtcaag gccaagggca cgctgacgat cggcgtcaag       120
     aacgactacc cgccttacgg cttcctcaac gacaagggcg agatcgtcgg cttcgaggtg       180
     gatctcggca agtacatcgc caaggaactg ctcggccccg aaggcaagtt cgagctggtg       240
     cccgtggtcg ccgccaaccg catcgaattc ctgaattccg gccgcatcga catcatcctc       300
     gccacgctcg gcgtcaccga ggagcgcggc aaggtgatcg acttctcgga atattacgtc       360
     tcggcgccgg gaccctcggt catcgccccc aaggcggcga ccttcagcaa gtgggaagag       420
     ctcaagggtc tcacgctctg cggcatccag ggctcctact acaacaagca cctgtccggc       480
     gacctcggca tccagctcac cgcgttcaag acgcagccgg aggcctaccg tgcgctcaag       540
     gacaatcgct gcgtcggctt cgtcttcgac gacatgacgc tgcgccagaa gaccgaggag       600
     gccgattggg cgggctacaa gatcgccgtc gacccctatg agtacatccc gcaggcggcc       660
     ggcatccgca agaacgacgt ggcgttccgc gacgcggtga acaaggcgat caccaaggcc       720
     gaagccgagg gcaagctgat cgagtgggaa accacctacg gcatgccccc tgccaagtac       780
     atcgccgagc gggccaaggc cgccgccgcc aagctgaagc cgtga                       825
//

If you have problems or comments...

PBIL Back to PBIL home page