(data stored in ACNUC1104 zone)

EMBL: CP002026.PE382

CP002026.PE382       Location/Qualifiers
FT   CDS_pept        387996..388760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0386"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="KEGG: mlo:mll9009 transcription regulator; PFAM:
FT                   regulatory protein IclR; Transcriptional regulator IclR;
FT                   SMART: regulatory protein IclR"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87719"
FT                   /db_xref="GOA:D7A301"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7A301"
FT                   /inference="protein motif:PFAM:PF09339"
FT                   /protein_id="ADH87719.1"
FT                   /translation="MAAPTASGSQLLDRAALLLDLIADGTSEGATLKELVERSGLNTAT
FT                   CHRILNTLVGHRLLARDDKRKRYRLGAKMFIYGARAARGPGLISRCEMSLSRLRKKTGE
FT                   TTHLMARHNHDSLCLDRRDGECVVQTLTGSIGGSVPLGAGPGSIAMLAFLDREEQEFIL
FT                   RANEPRFAAFRDLAADKVWRLIEETRARGHAVDIGELIPGIAGVAMPILDETGVPVASL
FT                   GFTFLCAKIVPGLVENYAALLRAEIDLIERRS"
     atggcagctc ccacggcgag cggttcgcaa ctcctcgatc gggcggcctt gctgctcgat        60
     ctcatcgccg atggaacgtc ggagggagcg acgctgaagg agctcgtgga aaggtccggg       120
     ctcaacaccg cgacctgcca ccgcatcctc aacacgctgg tcgggcaccg gctgctggcc       180
     cgtgacgaca agcgcaagcg ctatcggctc ggggccaaga tgttcatcta tggcgcgcgg       240
     gccgcgcgtg ggccgggcct catcagccgc tgcgagatga gcctgtcgcg gctgcgcaag       300
     aagaccggcg agaccacgca tctgatggcg cggcacaacc acgattccct ctgtctcgat       360
     cgtcgcgacg gggaatgcgt ggtgcagacc ctgaccggtt ccatcggcgg ctccgtgccg       420
     ctcggcgccg ggcccggcag catcgccatg ctggccttcc tcgaccgcga ggagcaggag       480
     ttcatcctgc gcgccaacga gccgcgcttc gccgccttcc gcgacctcgc cgcggacaag       540
     gtgtggcggc tgatcgagga gacgcgggcg cgcggccacg cggtcgacat cggtgaactc       600
     atccccggca ttgccggcgt cgccatgccg atcctcgacg agaccggcgt gccggtcgcc       660
     tcgctcggct tcaccttcct ctgcgccaag atcgtgcccg gcctggtgga gaactatgcg       720
     gccctgttgc gcgccgagat cgacctgatc gagaggcgga gctga                       765
//

If you have problems or comments...

PBIL Back to PBIL home page