(data stored in ACNUC1104 zone)

EMBL: CP002026.PE383

CP002026.PE383       Location/Qualifiers
FT   CDS_pept        complement(388768..389469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0387"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   ara:Arad_9641 short-chain dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87720"
FT                   /db_xref="GOA:D7A302"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7A302"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADH87720.1"
FT                   /translation="MTARTVLISGGGRGIGAATGRVMMQAGWNVSLGMRSPALPDWAEE
FT                   GPGQVQACAYEATDPAAAERWVAEARARFGGIDAVVANAGIMIRKDVIAAEDEELARLM
FT                   EVHVAAPRRLAKAAWNDLAASGRGRVIIVSSLSGKRVKSAISSLYSVSKFAATGLAHAL
FT                   RHTGFELGIRATAVCPGFVATDMGLPLTTRTAEELTDPADIGRAIRFLIELPNTSSVAE
FT                   FAVNWTLEESF"
     atgaccgcac gcaccgttct catctccggc ggcgggcgcg gcatcggcgc ggccaccggc        60
     cgcgtcatga tgcaggccgg ctggaacgtc tcgctcggca tgcgcagccc ggctttgccc       120
     gactgggcgg aggaaggtcc cggccaggtg caggcctgcg cctatgaggc gaccgatccg       180
     gccgcggccg agcgctgggt ggcggaggcg cgcgcccgct tcggcggcat cgacgcggta       240
     gtggccaatg ccggcatcat gatccgcaag gacgtgatcg ccgccgaaga cgaggaactt       300
     gcgcggctga tggaggtgca tgtcgccgcg ccgcgccggc tcgccaaggc ggcctggaac       360
     gaccttgccg ccagcgggcg gggacgggtg atcatcgttt cctcgctctc cggcaaacgg       420
     gtgaaatcgg cgatctccag cctctattcg gtgtcgaaat tcgccgccac cgggctcgcc       480
     catgcgctgc gccacaccgg cttcgagctc ggcatccgcg cgaccgcggt ctgcccgggc       540
     ttcgtcgcca ccgacatggg gctgccgctc accacccgca cggccgagga actgaccgac       600
     ccggccgata tcggccgcgc catccgcttc ctgatcgagc tgcccaacac gtcgagcgtc       660
     gccgagttcg cggtcaactg gacgctggaa gagtcgttct ga                          702
//

If you have problems or comments...

PBIL Back to PBIL home page