(data stored in ACNUC1104 zone)

EMBL: CP002026.PE385

CP002026.PE385       Location/Qualifiers
FT   CDS_pept        391052..391342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0389"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: GK23758 gene product from transcript
FT                   GK23758-RA"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87722"
FT                   /db_xref="UniProtKB/TrEMBL:D7A304"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH87722.1"
FT                   /translation="MSRVPATLLAVIMLAASAAAPAFAQDAGTMPGNLNNLNQPVIPPG
FT                   NPDNLNPGADAPQPLTGELVPLPGPPPVGGAADLKLPDCAPPNCGTPQIMQ"
     atgtcgagag ttccagctac cctgttggcc gtcattatgt tggcggcatc cgccgcggcg        60
     ccggcattcg cccaggatgc gggcacgatg cccggcaacc tcaacaacct gaaccagccg       120
     gtgattccgc ccggcaaccc cgacaatctg aaccccggcg ccgacgcgcc gcagcccctc       180
     accggggagc tggtgcctct gcccggcccg ccgccggtgg gcggcgcagc cgatctcaag       240
     ctgccggact gcgctccgcc caattgcggc acgccgcaga tcatgcagta g                291
//

If you have problems or comments...

PBIL Back to PBIL home page