(data stored in ACNUC1104 zone)

EMBL: CP002026.PE390

CP002026.PE390       Location/Qualifiers
FT   CDS_pept        396311..396970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0394"
FT                   /product="(2Fe-2S)-binding domain protein"
FT                   /note="PFAM: [2Fe-2S]-binding domain protein; ferredoxin;
FT                   KEGG: azc:AZC_1402 putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87727"
FT                   /db_xref="GOA:D7A309"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:D7A309"
FT                   /inference="protein motif:PFAM:PF01799"
FT                   /protein_id="ADH87727.1"
FT                   /translation="MHSHSEPGLSRRDLLAAGAATVAGSAAVGPAHAQDAVSTTSVDTA
FT                   PRAPIHAPVRFTVNGRAQALELDTRTSLLDALREHLHLTGTKKGCDHGQCGACTVMVDG
FT                   VRINSCLTLAVMHEGAEVTTIEGLGTPERLHAMQAAFVKHDGYQCGYCTPGQICSAVAV
FT                   LDEIKAGIPSHVTADITATPEFSVDEVRERMSGNICRCGAYSNIIEAITEVAGRAA"
     atgcatagcc attccgaacc cgggctctcg cgccgcgacc tgctcgccgc gggtgccgcg        60
     accgtcgccg gaagtgcggc tgtgggtccc gcgcacgctc aagatgcggt gagcacgacg       120
     tccgtcgaca ccgcgccgcg cgcgccgatc cacgctcccg tccgcttcac cgtcaacggc       180
     cgcgcgcagg cgctggagct cgatacccgc acctcgctgc tcgacgcgct gcgcgagcat       240
     ctccacctca ccggcaccaa gaagggctgc gatcacggcc agtgcggcgc ctgcacggtg       300
     atggtcgacg gggtgcgcat caattcctgc ctgacgctgg cggtgatgca cgagggcgcc       360
     gaggtcacca ccatcgaggg gctcggcacg ccggagcggc tgcacgcgat gcaggccgcc       420
     ttcgtcaagc atgacggcta ccagtgcggc tattgcacgc ccggccagat ctgttcggcc       480
     gtggcggtgc tcgatgagat caaggccggc attccgagcc acgtcaccgc cgacatcacc       540
     gcgacgccgg aattctcggt cgacgaggtc cgcgagcgca tgagcggcaa tatctgccgc       600
     tgcggcgcct attccaacat catcgaggcc atcaccgagg tggcggggag ggcggcatga       660
//

If you have problems or comments...

PBIL Back to PBIL home page