(data stored in ACNUC1104 zone)

EMBL: CP002026.PE393

CP002026.PE393       Location/Qualifiers
FT   CDS_pept        400254..400844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0397"
FT                   /product="response regulator receiver and ANTAR domain
FT                   protein"
FT                   /note="KEGG: azc:AZC_0692 two-component response regulator;
FT                   PFAM: ANTAR domain protein; response regulator receiver;
FT                   SMART: response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87730"
FT                   /db_xref="GOA:D7A312"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR008327"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D7A312"
FT                   /inference="protein motif:PFAM:PF03861"
FT                   /protein_id="ADH87730.1"
FT                   /translation="MTADPALRIVIVDESPLRAAILEEGLREAGYRNVLRLPERHDLLA
FT                   RLHAIDPDVIVIDLEDPSRDVIEQMFQVSREVKRPIAMFVDQSDSSTIAAAIDAGVSAY
FT                   IVDGLKKERVKPIIDMTISRFRAFARLREELEQTRTELEERKTIDRAKGILMKMKGLDE
FT                   PQAYALLRRTAMNEKRRLVDIAQSVITAAELLK"
     atgacggccg accccgccct tcgtatcgtc atcgtcgacg agagcccgtt gcgggccgcc        60
     atcctggagg agggcctgcg cgaggcgggc taccgcaacg tgctgcgcct gcccgagcgc       120
     cacgatctgc tggcgcgtct gcacgccatc gatcccgacg tgatcgtcat cgacctcgaa       180
     gacccctcgc gcgacgtcat cgagcagatg ttccaggtca gccgcgaggt gaagcggccc       240
     atcgccatgt tcgtcgacca gtcggacagc tcgaccatcg ccgcggcgat cgacgccggc       300
     gtctccgcct acatcgtcga cgggctgaag aaggagcgcg tcaagccgat catcgacatg       360
     acgatcagcc gcttccgcgc cttcgcccgc ctgcgcgagg agctcgaaca gacccgcacc       420
     gagctcgagg agcgcaagac catcgaccgc gccaagggca tcctgatgaa gatgaagggg       480
     ctggacgagc cgcaggccta cgccctgctg cgtcgtaccg cgatgaacga gaagcggcgc       540
     ctcgtcgaca tcgcccaatc cgtcatcacc gcggcggagc tgctgaaatg a                591
//

If you have problems or comments...

PBIL Back to PBIL home page