(data stored in ACNUC1104 zone)

EMBL: CP002026.PE395

CP002026.PE395       Location/Qualifiers
FT   CDS_pept        402558..403895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0399"
FT                   /product="nitrate-binding protein NrtA precursor,
FT                   periplasmic"
FT                   /note="KEGG: xau:Xaut_2504 nitrate-binding protein NrtA
FT                   precursor, periplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87732"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:D7A314"
FT                   /inference="similar to AA sequence:KEGG:Xaut_2504"
FT                   /protein_id="ADH87732.1"
FT                   /translation="MTDTPSRRSKSRSDSRLSRRSFLKVSAATLGTASLVEALRFSFPG
FT                   GVPSAYAAGPETTKAVLGYIALMDASPLVIAKEKGLFAKHGVPDVEVVKQASWGATRDN
FT                   LVLGGAANGIDGAHILSPMPYLISTGKVTQNNVPTPMYILARLNLDAQAISVSNEYKDL
FT                   KVTTDASALKAAFAAKKAAGKEVKVAMTFPGGTHDLWLRYWLAAAGIDPDKDVSTIVVP
FT                   PPQMVANMKVGNMDAFCVGEPWNEQLVNQGIGYTACTTGEIWKHHPEKALGMRADFVEK
FT                   NPNATRAILMAVMEAQQWCDQPANKEEMSTIVGKRQWFNVPVADILGRAKGDINYGNGR
FT                   VVKGSDQYMKFWQDQASYPFKSHDAWFVTEDMRWGKFEPTTDVKALVDKVNREDLWRDA
FT                   AKALGVAAADVPSSTSRGKETFFDGKVFDPGDPSAYLASLEIKRVA"
     atgaccgata cgccgtcccg ccgcagtaag tcccgtagcg attcccgcct gtcccgccgc        60
     tccttcctca aggtgtcggc cgccacgctc ggcacggcca gcctcgtcga ggcgctgcgc       120
     ttttccttcc ccggcggcgt gccctccgcc tacgccgcgg ggcccgagac caccaaggcc       180
     gtgctcggct acatcgcgct gatggatgcg agcccgctcg tcatcgccaa ggagaagggc       240
     ctgttcgcca agcacggcgt acccgacgtc gaggtggtga agcaggcctc ctggggcgcc       300
     acccgcgaca atctcgtgct cggcggcgcc gccaacggca tcgacggcgc ccacatcctc       360
     tcgccgatgc cctacctcat ctccaccggc aaggtgacgc agaacaacgt gccgacgccg       420
     atgtacatcc tcgcgcggct caatctcgac gcgcaggcga tctccgtctc caacgaatac       480
     aaggacctca aggtcaccac cgacgcctcg gcgctgaagg ccgccttcgc cgccaagaag       540
     gcggcgggca aggaagtgaa ggtcgccatg accttcccgg gtggcacgca cgacctctgg       600
     ctgcgctact ggctcgccgc cgccggcatc gacccggaca aggacgtctc caccatcgtg       660
     gtgccgccgc cgcagatggt ggcgaacatg aaggtcggca acatggacgc cttctgtgtc       720
     ggcgagccgt ggaacgagca gctcgtcaac cagggcatcg gctacaccgc ctgcaccacc       780
     ggcgagatct ggaagcacca tccggagaag gcgctcggca tgcgcgccga cttcgtcgag       840
     aagaacccga acgccacccg cgccatcctg atggcggtga tggaagccca gcaatggtgc       900
     gaccagccgg ccaacaagga ggagatgtcg accatcgtcg gcaagcggca atggttcaac       960
     gtgccggtcg ccgacatcct cggccgggcg aagggcgaca tcaactacgg caatggccgg      1020
     gtggtgaagg gctccgacca gtacatgaag ttctggcagg accaggcttc ctatcccttc      1080
     aagagccatg acgcctggtt cgtcaccgag gacatgcgct ggggcaagtt cgagcccacg      1140
     accgacgtca aggcgctggt cgacaaggtg aaccgcgagg acctctggcg cgacgccgcc      1200
     aaggcgctgg gcgtggcggc ggcggacgtc ccgtcctcca cctcgcgcgg caaggagacc      1260
     ttcttcgacg gcaaggtctt cgatccgggc gatccctccg cctacctcgc cagcctcgag      1320
     atcaagcggg tcgcctga                                                    1338
//

If you have problems or comments...

PBIL Back to PBIL home page