(data stored in ACNUC1104 zone)

EMBL: CP002026.PE397

CP002026.PE397       Location/Qualifiers
FT   CDS_pept        404871..405665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0401"
FT                   /product="nitrate ABC transporter, ATPase subunits C and D"
FT                   /note="TIGRFAM: nitrate ABC transporter, ATPase subunits C
FT                   and D; PFAM: ABC transporter related; KEGG: azc:AZC_0684
FT                   nitrate transport ATP-binding subunits C and D protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87734"
FT                   /db_xref="GOA:D7A316"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005890"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7A316"
FT                   /inference="protein motif:TFAM:TIGR01184"
FT                   /protein_id="ADH87734.1"
FT                   /translation="MTAYLKLDHIDKVFARGGNVTEVLKEVSLDVTRGEYISIIGHSGC
FT                   GKSTLLNIVAGLTPATTGGVILEGRQVDGPGPDRAVVFQNHSLLPWLSVYDNVRLAVDK
FT                   VFSGVKNRAERHDWTLHNLELVQMVHAKDKRPAEISGGMKQRVGIARALAMEPKVLLLD
FT                   EPFGALDALTRAHLQDSVMQIHAAIGNTVLMITHDVDEAVLLSDRIVMMTNGPSARIGE
FT                   VLDVELPRPRRRLDLVTDPTYLACREAVLKFLYERHRFVEAA"
     atgaccgcct atctcaagct agaccacatc gacaaggtct tcgcccgcgg cggcaatgtc        60
     accgaggtgc tgaaggaagt ctcgctcgac gtcaccaggg gcgagtacat ctccatcatc       120
     ggccattccg gctgcggcaa gtccaccctg ctcaacatcg tcgccggcct caccccggcg       180
     accacgggtg gcgtcatcct cgaaggccgg caggtcgacg gccccggccc cgaccgtgcc       240
     gtcgtgttcc agaaccactc gctgctgccc tggctgtcgg tctacgacaa tgtccgcctc       300
     gccgtggaca aggtgttctc cggcgtgaag aaccgcgccg agcggcacga ctggaccctg       360
     cacaatctcg aactggtgca gatggtccac gcgaaggaca agcgccccgc cgagatttcc       420
     ggcggcatga agcagcgcgt cggcatcgcc cgcgcgctcg ccatggagcc caaggttctt       480
     cttctggacg aacccttcgg cgcgctcgac gcgctcaccc gcgctcatct gcaggattcg       540
     gtcatgcaga tccacgccgc catcggcaac accgtgctga tgatcaccca cgatgtcgac       600
     gaggcggtgc tgctctccga ccgcatcgtg atgatgacca acggcccctc ggcgcgcatc       660
     ggcgaggtgc tcgacgtcga gctgccgcgc ccgcgccgcc gactcgatct ggtgaccgac       720
     cccacctacc tcgcctgccg cgaggcggtg ctgaagttcc tctacgagcg ccaccgcttc       780
     gtcgaagccg cctga                                                        795
//

If you have problems or comments...

PBIL Back to PBIL home page