(data stored in ACNUC1104 zone)

EMBL: CP002026.PE398

CP002026.PE398       Location/Qualifiers
FT   CDS_pept        405676..406137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0402"
FT                   /product="globin"
FT                   /note="PFAM: globin; KEGG: azc:AZC_0683 putative
FT                   hemoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87735"
FT                   /db_xref="GOA:D7A317"
FT                   /db_xref="InterPro:IPR000971"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="UniProtKB/TrEMBL:D7A317"
FT                   /inference="protein motif:PFAM:PF00042"
FT                   /protein_id="ADH87735.1"
FT                   /translation="MTPERIALVRESFAKVRPIADDAAALFYGRLFQIAPEVRPLFPAD
FT                   LTEQGRKLMTTLAVVVNSLDDLPALLPVVQRLGARHAGYGVTGEHFAPVGAALLWTLEK
FT                   GLGEGFTPEVRMAWTEAYHVLATVMIDALKSAAPPVQESPFGRIVGVQP"
     atgacgcccg agcgcatcgc tctcgtccgc gagagcttcg ccaaggtccg ccccatcgcc        60
     gatgatgccg ccgccctctt ctacggccgc ctgttccaga tcgcgccgga ggttcgtccg       120
     ctgtttccgg ccgacctcac cgagcagggc cgcaagctga tgaccacact ggcggtggtc       180
     gtgaatagcc tggacgacct gccggcactg ctgccggtgg tgcagcggct cggcgcccgc       240
     catgccggct acggcgtgac cggcgagcac ttcgcgccgg tcggcgcggc gctgctgtgg       300
     acgctggaga aggggctggg cgagggcttc acgcccgagg tccgcatggc ctggaccgag       360
     gcctatcacg tcctcgctac ggtgatgatc gatgccctca agtcggcggc gccgccggtg       420
     caggaatcgc ccttcggccg catcgtcggg gtgcagccat ga                          462
//

If you have problems or comments...

PBIL Back to PBIL home page