(data stored in ACNUC1104 zone)

EMBL: CP002026.PE4

CP002026.PE4         Location/Qualifiers
FT   CDS_pept        2010..3509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0004"
FT                   /product="DNA methylase N-4/N-6 domain protein"
FT                   /note="PFAM: DNA methylase N-4/N-6 domain protein; KEGG:
FT                   bbt:BBta_6611 site-specific DNA-methyltransferase
FT                   (adenine-specific)"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87341"
FT                   /db_xref="GOA:D6ZZS7"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZS7"
FT                   /inference="protein motif:PFAM:PF01555"
FT                   /protein_id="ADH87341.1"
FT                   /translation="MTPETFLDGRVTLYCGDSRDALDLIEPNSVDNCVCDPPYALVSIG
FT                   KRFGKEGAAPAKGGVYQRASGGFMGQSWDTGEVAFDAKFWRKVFRALKPGGHVIAFGGT
FT                   RAYHRLAVAIEDAGFEIRDSIGDLISLDPMVRAFVDSLDEAQLDAFLRIADLIGFEGLL
FT                   AWVYGTGFPKSHDVSKAIDKMAGAERPVVGFDPVAAKRTSKFGTNSYGDFKGQNGDVTA
FT                   PATAAAAAWQGWGTALKPAWEPIVLARKPLIGTVAENVLEHGTGALNVDGCRVGDEVRT
FT                   AAFTSLAPCHGNALGAAGTAEACRGTQGEPKEYVGRHPANIIHDGTDEVVSAFPETESG
FT                   AGAVKRATAAGHQGNALGRESRPAGTPMISHGDSGSASRFFYSAKADADDRLGSKHPTV
FT                   KPVDLMQWLVRLVTAKGGTVLDPFAGTGTTGEAAWREGCNAVLIERNPPYQADIRRRMA
FT                   LCTAGSATRKRAARLARAEAEGKAPEFGPLFGGLTGPEAAE"
     atgacgcctg aaaccttcct cgacgggcgg gtgacgctct attgcggcga cagccgggat        60
     gctctcgatc tcattgagcc gaacagcgtc gacaattgcg tgtgcgaccc gccctatgcg       120
     ctggtttcga tcggcaagcg cttcggcaag gagggcgccg cgccggccaa gggcggcgtc       180
     tatcagcgcg cctcgggcgg cttcatgggg cagagctggg acaccggcga agtcgccttc       240
     gacgcgaagt tctggcgcaa ggttttccgc gcgctgaagc ccggtgggca tgtgatcgcc       300
     ttcggcggga cgcgggccta ccaccggctg gccgtcgcca ttgaagatgc gggtttcgag       360
     atccgcgatt ccatcggcga cctgatcagc ctcgatccga tggtgcgggc cttcgtcgac       420
     agcctcgacg aggcgcagct cgacgccttc ctgcgcatcg ccgacctgat cggcttcgaa       480
     gggttgctcg cctgggtgta cggcaccggc tttcccaaga gccacgacgt gagcaaggcc       540
     atcgacaaga tggcgggcgc ggagcggccc gtggtcggct tcgaccccgt tgcggcaaaa       600
     cgaacgtcga agttcggcac gaattcctac ggcgacttca aaggccagaa cggcgatgtg       660
     accgcaccgg caactgctgc tgctgctgct tggcagggct ggggcacggc gctgaaaccg       720
     gcgtgggagc cgatcgtact cgcccgcaag ccgctgattg gcacggtggc ggagaacgtg       780
     ctcgagcacg gcaccggggc gctgaacgtc gacgggtgcc gggtcggcga cgaggtgcgc       840
     actgccgcgt tcacctcgct cgccccgtgt cacggcaatg ccctcggcgc cgcaggcacc       900
     gcggaagcgt gccgtggaac gcagggcgag ccgaaggagt acgtcgggcg ccatccggcc       960
     aacatcatcc atgatggcac cgacgaggtg gtgtccgctt ttccggaaac ggagagcggc      1020
     gccggcgccg tgaagcgcgc tacggcggcc gggcatcaag gcaacgccct tgggcgcgag      1080
     tctcgcccgg ccggcacgcc gatgatcagc cacggcgata gcggctccgc ctcccgcttc      1140
     ttttactccg ccaaggcgga tgccgatgac cggctcggct ccaagcaccc gacggtgaag      1200
     cctgtagacc tgatgcagtg gctggtgcgg ctggtgacgg ccaagggcgg cacggtgctg      1260
     gacccgttcg ccggcaccgg caccaccggg gaagcggcgt ggcgcgaggg ctgcaacgcc      1320
     gtgctgatcg agcggaaccc gccttaccag gccgatatcc gccgccgcat ggcgctgtgc      1380
     accgccggca gtgcgacccg caagcgcgcc gcccggctcg cccgcgccga ggcggaagga      1440
     aaggcgccgg aattcggccc gctgttcggc ggcctcacag gaccggaggc cgcagaatga      1500
//

If you have problems or comments...

PBIL Back to PBIL home page