(data stored in ACNUC1104 zone)

EMBL: CP002026.PE40

CP002026.PE40        Location/Qualifiers
FT   CDS_pept        complement(30969..32477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0040"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rop:ROP_06080 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87377"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZW3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH87377.1"
FT                   /translation="MLNPKYDQQVQSQIGQYSTVENMHNAAAAANWFNSRFLRPRMRQV
FT                   SGTESVAEFYAVHIAEAVARTGLDVAVSLGAGYGSLEIDIINLARSRGLPAFHLKCFEL
FT                   SPVLVDRANRAIREQGLEDFVSAQVVDLNVDLPLAGNVAAFMAHHSLHHLVELERIFDQ
FT                   VNSYLPPEGAFITMDMIGRNGHMRWPETLGIIRELWPALPDRLKWDHQLSRFDRWFENW
FT                   DCSIEGFEGIRSQDILPALLERFKFERFLAYGGLSEIFTDRSFGPNFDPNNPPDANFLS
FT                   QIKALEDDLIRAEQVKPTQLIAVMRPLRSHDCPGEAICFEGLTPTKAVRSADRQDFGAP
FT                   HLGNTSFVSPFPAPDEEPAIPMVACGAPIHFVPGGNGAALTRWGWAEPDPDFTWSVGLA
FT                   SALRFRAAEGAAGILLKFVDVRPPTTERRFLTLRLNDREVASIELDGIEAVREISAAFP
FT                   DSLSPGDEALLEIELTRPLRPDVDDSVDRRPLGIGLISMSLAPA"
     atgttgaatc cgaaatacga ccaacaggtt caatcgcaaa tcggccaata ttcgaccgtc        60
     gagaacatgc acaacgccgc ggcggctgcg aattggttta attcgcgatt cctgcggcca       120
     cggatgcgtc aggtttccgg aaccgaaagt gtcgcagagt tctacgcagt acatattgcg       180
     gaagcggtcg caaggaccgg cctcgatgtt gccgtcagcc ttggcgctgg gtacgggtcg       240
     ctcgaaattg acattatcaa tctcgcgcgc agccggggtc tgcccgcttt tcaccttaag       300
     tgttttgagc tgtcgccagt gcttgtcgat cgcgcaaacc gcgccatacg cgagcagggt       360
     cttgaagact tcgtctccgc ccaggtggtc gacctgaacg tcgacctccc gctcgccggc       420
     aatgtggccg cgttcatggc gcatcattca cttcatcatc tggtcgagtt ggagagaata       480
     tttgaccagg tgaattccta tttgccgccc gagggcgcct tcatcacgat ggacatgatc       540
     ggccgcaacg gccacatgag gtggcccgag acgctcggca tcattcggga gttgtggccg       600
     gcgctgccgg acaggctgaa gtgggatcac cagctcagcc ggttcgatcg ctggtttgag       660
     aactgggatt gctcgataga ggggttcgaa ggcatcagat cgcaagatat tcttccggct       720
     cttctcgagc ggttcaagtt cgagcgattt ctggcctatg gtggcctctc agagatattt       780
     accgacagga gctttgggcc caattttgac ccgaacaatc cccccgacgc aaactttctc       840
     tcgcaaatca aggctctcga agacgacctc atcagagccg agcaagtcaa gccgacacag       900
     ctgattgcgg taatgcggcc gctccgttct cacgactgcc ctggcgaagc catttgcttc       960
     gagggtctca ctccaacgaa ggcggttcgc tcagctgacc gacaggactt cggagccccc      1020
     catcttggca acactagctt cgtctcgcct tttcctgctc ccgacgaaga acctgcaatt      1080
     ccgatggtgg cctgcggggc accaattcac ttcgtgcccg ggggcaacgg cgctgcactc      1140
     acgcggtggg gatgggccga accggaccca gacttcactt ggtccgtcgg cctcgcctcg      1200
     gcgcttcggt tccgcgcggc cgaaggtgct gctggcatac tcctgaagtt cgtcgacgtg      1260
     cggccgccca cgaccgaaag acggtttctg acccttcggt tgaatgatcg agaagtcgca      1320
     tcgattgagc tcgatggcat cgaagcagtt cgcgaaatat cagccgcatt tcccgattcg      1380
     ctgtcgccgg gggacgaggc cttgctcgag atcgagctaa cgagaccgct ccgtcctgac      1440
     gtcgatgaca gcgtggaccg tcgccccctt ggcattggcc taatttcgat gtcgcttgcg      1500
     ccagcatga                                                              1509
//

If you have problems or comments...

PBIL Back to PBIL home page