(data stored in ACNUC1104 zone)

EMBL: CP002026.PE401

CP002026.PE401       Location/Qualifiers
FT   CDS_pept        409186..410766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0405"
FT                   /product="oxidoreductase FAD/NAD(P)-binding domain protein"
FT                   /note="PFAM: oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; FAD-binding domain protein; Fe-S cluster domain
FT                   protein; KEGG: azc:AZC_0680 sulfite reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87738"
FT                   /db_xref="GOA:D7A320"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR003097"
FT                   /db_xref="InterPro:IPR007202"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023173"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:D7A320"
FT                   /inference="protein motif:PFAM:PF00175"
FT                   /protein_id="ADH87738.1"
FT                   /translation="MNAPMLQPMPAVSYLPETAPFSEEQRAWLNGFFAAVLAPPTGTPV
FT                   ALDAPAAPAIEDDGAPWHDPAMPLDERMKLAEGRPLPRRLMAAMAQQDCGQCGYVCESY
FT                   AAALAAGTEAKLNLCAPGGKETARMLKALAAELDGAPAAVPATSAPAAPVGAPGTSRDN
FT                   PALVTLVSRHRLNKGASEKETWHVEFDLAAAGLDYTVGDSFGIFPENDPALVAAVLAAI
FT                   GADGSEEIEGRTVADILARDVSLGGAPDGLFQLLTYLTGGEARRRARALAAGEDPDGDA
FT                   AGLDVLAALEKFGRPAIAAEVLVEALEPLQPRLYSISSSPKATPGRLSLTVDTVRYKLG
FT                   SRTRLGVGSTFLSGRLEPGTPMRAYVQKAHGFALPADPATPVIMVGPGTGVAPFRAFLW
FT                   ERMASGAKGRNWLFFGHQRSDCDFFYEDELSGMRAGGHLARLTLAWSRDGSEKVYVQDR
FT                   MREVGADLFAWLEEGAHFYICGDAKRMAKDVERALVEVVAAHGGRTTDDALAYVAGLKK
FT                   AGRYQADVY"
     atgaatgcac ccatgttgca gccgatgccg gccgtttcct acctgccgga aaccgcgccc        60
     ttcagcgagg aacagcgcgc ctggctgaac ggcttcttcg ccgccgtcct cgccccgccg       120
     accggcacgc cggtggcgct cgacgcaccc gccgcgccgg ccatcgagga cgacggcgcg       180
     ccctggcacg atcccgccat gcccctggac gagcgcatga agctggccga gggccgcccg       240
     ctgccgcggc gtcttatggc cgccatggcg cagcaggatt gcggccagtg cggctatgtc       300
     tgcgagagct acgccgccgc gctcgccgcc ggcaccgagg ccaagctcaa tctctgcgcc       360
     cccggcggca aggagacggc gcgcatgctg aaggcgctcg ccgccgagct ggatggcgcg       420
     cccgccgccg tgccggcgac gtcggcacct gctgcccctg tgggtgcccc cggcacctcg       480
     cgcgacaacc cggccctcgt caccctcgtc tcccgccatc ggctcaacaa gggcgcctcg       540
     gagaaggaga cgtggcacgt cgagttcgat ctcgccgccg ccgggctcga ctacacggtg       600
     ggcgacagct tcggcatctt cccggagaac gatccggccc tcgtcgccgc cgtgctggcc       660
     gcgatcggcg ccgacgggag cgaggagatt gagggccgca ccgtcgcgga catcctcgcc       720
     cgcgatgtct cgctcggcgg cgcgccggac gggctgttcc agctcctcac ctacctgacc       780
     ggcggcgagg cgcggcggcg cgcccgagcg ctggcggccg gcgaggaccc ggacggcgac       840
     gcggccggcc tcgacgtgct cgccgcgctg gaaaagttcg gccggcccgc catcgccgcc       900
     gaggtgctgg tcgaggcgct ggagccgctg cagccgcgcc tctattccat ttcgtcgagc       960
     ccgaaggcga cgcccggccg gctgtcgctg accgtcgaca cggtacgtta caagctcggc      1020
     agccgcaccc ggctcggcgt cggctcgacc ttcctgtccg gccggctgga gccgggcacg      1080
     ccgatgcgcg cctatgtgca gaaggcgcac ggcttcgccc tgccggccga tcccgcgacg      1140
     cccgtcatca tggttgggcc gggcaccggc gtcgcgccgt tccgcgcctt cctgtgggag      1200
     cggatggcga gcggcgccaa gggccgcaac tggctgttct tcggccatca acgcagcgac      1260
     tgcgacttct tctacgagga cgagctttcc ggcatgcgtg ccggcggcca cctcgcgcgc      1320
     ctgacgctcg cctggtcgcg cgacggctcc gagaaggtct atgtgcagga ccgcatgcgc      1380
     gaggtcggcg ccgacctgtt cgcctggctg gaggagggcg cgcatttcta catctgcggc      1440
     gacgccaagc gcatggccaa ggatgtcgag cgggcgctgg tcgaggtggt cgccgcccat      1500
     ggcggcagaa ccaccgacga cgccctcgcc tatgtcgccg gactgaagaa ggccggccgc      1560
     tatcaggcgg acgtctactg a                                                1581
//

If you have problems or comments...

PBIL Back to PBIL home page