(data stored in ACNUC1104 zone)

EMBL: CP002026.PE403

CP002026.PE403       Location/Qualifiers
FT   CDS_pept        complement(413474..414823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0407"
FT                   /product="putative PAS/PAC sensor protein"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: PAS fold domain
FT                   protein; Oxidoreductase FAD-binding domain protein;
FT                   oxidoreductase FAD/NAD(P)-binding domain protein; KEGG:
FT                   azc:AZC_2751 globin; SMART: PAS domain containing protein;
FT                   PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87740"
FT                   /db_xref="GOA:D7A322"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023950"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:D7A322"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ADH87740.1"
FT                   /translation="MHTLYMISAEANTMTDTAAATAQPAHVDQRGPRAFVVESRHKESE
FT                   VITSFVLRPADGRPPAPHEAGQHLTLFAEVPGHGRQKRNFTISSAPNGETYRITVKREP
FT                   AGTVTKWLHDSAEPGTRLDIARPDGSFVLPRGDERPIVMVSAGVGLTPMVAMLEEFVRE
FT                   KRHVRVQFVHCTQNGGTHALGKHVRDLAAASDGIETTFLYTRPESGDVAGRDFDISGHL
FT                   SLDWLAAHTPLNEAEYFVCGPLRFLRDFVPGLAQRGVPVERLNYEFFGPVEDLFGDATD
FT                   GGTTPSPQSGTVAARTARAVHGFSREQIGDALLDSAADAIIASATDGTIVLWNAGAERI
FT                   FGFTEEEALGQSLDIIIPEPFRARHWEGYDETIASGVSRYGAGDLLAVPGLHKDGRRIS
FT                   IEFTIVLMKDETGKVTGMVAALRDVTARFEETKALKKKLAALEAATGGNS"
     atgcatactc tatacatgat ttctgcagag gccaacacca tgaccgatac cgccgcggca        60
     acagcgcagc ccgctcatgt ggatcagcga ggcccccgcg ccttcgtcgt cgagagccgc       120
     cacaaggaga gcgaggtcat cacctccttc gtgctgcgcc cggcggatgg tcgcccgccg       180
     gcgccgcacg aggcggggca gcacctcacg ttgttcgccg aggtgccggg ccatggccgg       240
     cagaagcgca acttcaccat ctcctcggcg ccgaacggcg agacctaccg gatcacggtg       300
     aagcgcgagc ccgccggcac ggtcaccaaa tggctgcacg attcagctga gcccggcacg       360
     cggctcgaca tcgcccggcc ggacggcagc ttcgtgctgc cgcgcggcga cgagcgaccc       420
     atcgtcatgg tgagcgccgg cgtcgggctg acgccgatgg tggcgatgct ggaggaattc       480
     gtgcgcgaga agcgccacgt ccgcgtgcag ttcgtccact gcacccagaa cggcggcacg       540
     catgccctgg gaaagcacgt ccgcgacctc gccgccgcct cggacgggat cgagacgacc       600
     ttcctctaca cgcggcccga gagcggcgac gtggccgggc gcgacttcga catttccggc       660
     catctgagcc tcgactggct ggccgcgcat acgccgctca atgaggccga gtatttcgtc       720
     tgcgggccgc tgcgcttcct cagggacttc gtgccggggc tggcgcagcg cggcgtgcca       780
     gtggagcggc tgaactacga gttcttcggg ccggtcgagg acctgttcgg tgacgccacc       840
     gatggcggga cgaccccctc accgcaatcg ggcacggtcg ctgcgcgaac ggcgcgcgcg       900
     gtgcacggct tcagccgcga gcagatcggc gacgcactgc tcgacagcgc cgccgacgcc       960
     atcatcgcca gcgccaccga cggcaccatc gtgctgtgga acgccggcgc cgagcgcatc      1020
     ttcggcttca ccgaagagga ggcgctgggc cagtcgctcg acatcatcat ccccgagccg      1080
     ttccgcgccc ggcattggga aggctatgac gagacgatag cctcgggagt cagccgctat      1140
     ggcgccggcg acctgctggc ggtgccgggc ctgcacaagg acggacggcg catctcgatc      1200
     gagttcacca tcgtgctgat gaaggacgag accgggaagg tcaccggcat ggtcgccgcg      1260
     ctgcgcgacg tcaccgcccg cttcgaggag accaaggcgc tgaagaagaa gctggcggcg      1320
     ctggaggctg ccaccggcgg gaactcctag                                       1350
//

If you have problems or comments...

PBIL Back to PBIL home page