(data stored in ACNUC1104 zone)

EMBL: CP002026.PE404

CP002026.PE404       Location/Qualifiers
FT   CDS_pept        414860..415315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0408"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /note="KEGG: pde:Pden_1690 BadM/Rrf2 family transcriptional
FT                   regulator; TIGRFAM: transcriptional regulator, Rrf2 family;
FT                   PFAM: protein of unknown function UPF0074"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87741"
FT                   /db_xref="GOA:D7A323"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR030489"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7A323"
FT                   /inference="protein motif:TFAM:TIGR00738"
FT                   /protein_id="ADH87741.1"
FT                   /translation="MRLTRYSDYAMRVMLYLAARGDRPCSISEMAAAYGISQNHLMKVM
FT                   NDLGRAGYVASTRGRNGGFRLARPANEIVVGDLLRHTEDDLDLVDCPRCVLSRGCGLSS
FT                   VLDEALMAFLAVLDRYTLADLIDRRQGFQSLLLSLDSGMGRIQPGLA"
     atgcgactga cccgctactc cgattacgcc atgcgcgtga tgctctatct cgcggcacgc        60
     ggcgaccgtc cgtgctccat atcggagatg gcggcagcct acggtatttc gcagaaccac       120
     ctgatgaagg tcatgaacga cctagggcgg gccggctatg tggcgagcac gcgcgggcgc       180
     aatggcggct tccggctggc gcggccggcg aacgagatcg tggttggcga cctgctgcgg       240
     cacaccgagg acgatctcga cctcgtcgat tgcccgcgtt gcgtgctgtc gcgcggctgc       300
     ggcctatcct cggtgctgga cgaggcgctg atggcgttcc tcgccgtgct cgaccgctac       360
     acgctggcgg acctcatcga ccggcggcag ggcttccaga gcctgctgct ttccctcgat       420
     tccggcatgg gccggattca gcccggactg gcgtga                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page