(data stored in ACNUC1104 zone)

EMBL: CP002026.PE406

CP002026.PE406       Location/Qualifiers
FT   CDS_pept        complement(416483..416920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0410"
FT                   /product="Protein of unknown function DUF1810"
FT                   /note="PFAM: Protein of unknown function DUF1810; KEGG:
FT                   bid:Bind_2803 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87743"
FT                   /db_xref="InterPro:IPR014937"
FT                   /db_xref="InterPro:IPR036287"
FT                   /db_xref="UniProtKB/TrEMBL:D7A325"
FT                   /inference="protein motif:PFAM:PF08837"
FT                   /protein_id="ADH87743.1"
FT                   /translation="MDDPYDLKRFVSAQETVFDTAVAELRAGRKRSHWMWFIFPQLRGL
FT                   GRSPTAEFYGIGSLKEARAYLAHPVLGPRLERATQAVPLESGRSLHDIFGSPDDMKFRS
FT                   SMTLFALACDAPDSVFRRALDLGCAGDMDKATLALLDEERA"
     gtggacgatc cctatgacct caagcgcttc gtcagcgcgc aggagacggt cttcgacacg        60
     gcggtcgcgg agctgcgcgc cgggcgcaag cgcagccact ggatgtggtt catcttcccg       120
     cagctgcgcg ggctcggccg ctcgccgacg gccgagttct acggcatcgg ctcgctgaag       180
     gaggcgcggg cctatctcgc ccatcccgtg ctcgggccgc ggctggagcg cgccacgcag       240
     gcggtgccgt tggagagcgg ccggtcactg cacgacatct tcggcagccc ggacgacatg       300
     aagttccgct cgtccatgac gctattcgcg ctagcctgcg atgcgcccga cagcgtgttc       360
     cgccgggcgc tcgacctcgg atgcgccggc gacatggaca aggcgacgct ggcgctgctg       420
     gacgaggaga gggcctga                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page