(data stored in ACNUC1104 zone)

EMBL: CP002026.PE407

CP002026.PE407       Location/Qualifiers
FT   CDS_pept        416995..417441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0411"
FT                   /product="protein of unknown function DUF296"
FT                   /note="PFAM: protein of unknown function DUF296; KEGG:
FT                   sme:SM_b20067 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87744"
FT                   /db_xref="InterPro:IPR005175"
FT                   /db_xref="InterPro:IPR025707"
FT                   /db_xref="UniProtKB/TrEMBL:D7A326"
FT                   /inference="protein motif:PFAM:PF03479"
FT                   /protein_id="ADH87744.1"
FT                   /translation="MKSKLLGEGEGGRLFALVLDPGEEAFAAIRDFAAKEGISAASVTA
FT                   IGAFSRATVGWFDFDTRDYRRIPVEEQCEVLSALGDIARDDDGKASLHLHAVLGLSDGS
FT                   TRGGHLLDGIVRPTLEVMITETPAHLHRRKRPGLGISLIDLGSG"
     atgaaatcca agttgctcgg cgaaggcgag ggtggtcgcc tgttcgcgct cgtgctcgat        60
     cccggcgaag aggcgttcgc cgccatccgc gacttcgccg cgaaggaggg gatcagtgcc       120
     gcctccgtca ccgccatcgg cgccttctcg cgggcgacgg tcggctggtt cgatttcgac       180
     accagggact atcgccgcat cccggtcgag gagcagtgcg aggtgctgag cgcgctcggc       240
     gacatcgccc gcgacgacga cggcaaggcg agcctgcatc tgcacgccgt actcggcctg       300
     tccgacggct cgacccgcgg cgggcacctg ctcgacggca ttgtccggcc gacgctggag       360
     gtgatgatca ccgagacccc ggcgcatctg caccgccgaa agcgccccgg cctcggcatc       420
     tcgctcatcg acctcggcag cgggtga                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page