(data stored in ACNUC1104 zone)

EMBL: CP002026.PE409

CP002026.PE409       Location/Qualifiers
FT   CDS_pept        complement(418566..418751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0413"
FT                   /product="putative glutamine synthetase translation
FT                   inhibitor GstI-like protein"
FT                   /note="KEGG: bra:BRADO3394 putative glutamine synthetase
FT                   translation inhibitor GstI-like"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87746"
FT                   /db_xref="InterPro:IPR021232"
FT                   /db_xref="UniProtKB/TrEMBL:D7A328"
FT                   /inference="similar to AA sequence:KEGG:BRADO3394"
FT                   /protein_id="ADH87746.1"
FT                   /translation="MRTNIQRASAQIVQFPVGGRAGLAARRAELRASEPLKVNPAVIFG
FT                   SWYHEEAIREDAGPKN"
     atgcgtacca acatccagcg cgcaagcgcg cagatcgtcc agttccctgt cggtggccgc        60
     gcgggtcttg ccgcccgtcg cgccgagctt cgcgcttccg agccgctcaa ggtaaacccg       120
     gccgtcatct tcggcagctg gtaccacgaa gaggccattc gggaagacgc tggccccaag       180
     aactga                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page