(data stored in ACNUC1104 zone)

EMBL: CP002026.PE41

CP002026.PE41        Location/Qualifiers
FT   CDS_pept        complement(32885..33166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0041"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87378"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZW4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH87378.1"
FT                   /translation="MGITHTAAMQPYEIIRKNITKVGPDWQIAPDQPPVDMRVWSGFVA
FT                   FVPGDRAEIKKRVDAVRISFTADLLPAEGGVWVLAGYSDLAKILKALR"
     atgggaatca cccataccgc cgccatgcag ccctacgaga ttatccggaa aaatatcacc        60
     aaggtcgggc cagactggca gatcgccccc gatcagccgc cagtcgacat gcgcgtctgg       120
     agcggcttcg ttgccttcgt gccgggcgac agggccgaga tcaagaagcg cgtcgatgcc       180
     gtgcggatca gctttacggc cgacctgctg cctgccgagg gcggcgtctg ggtgctcgcc       240
     ggctacagcg acctcgccaa gatattgaaa gccttgcgct ag                          282
//

If you have problems or comments...

PBIL Back to PBIL home page