(data stored in ACNUC1104 zone)

EMBL: CP002026.PE410

CP002026.PE410       Location/Qualifiers
FT   CDS_pept        419202..420236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0414"
FT                   /product="Glutamate--ammonia ligase"
FT                   /EC_number="6.3.1.2"
FT                   /note="KEGG: met:M446_4572 glutamate--ammonia ligase; PFAM:
FT                   glutamine synthetase catalytic region; glutamine synthetase
FT                   beta-Grasp"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87747"
FT                   /db_xref="GOA:D7A329"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:D7A329"
FT                   /inference="protein motif:PRIAM:6.3.1.2"
FT                   /protein_id="ADH87747.1"
FT                   /translation="MTKYKLEYIWLDGYKPTPNLRGKTQIKEFDHFPSLEELPLWGFDG
FT                   SSTEQAEGRSSDCVLKPVAIYPDPARKNGALVMCEVMMPDGVTPHATNARATILDDEGA
FT                   WFGFEQEYFFYKDGRPLGFPEHGYPAPQGPYYTGVGFKNVGDIAREIVEEHLELCLEAG
FT                   INHEGINAEVAKGQWEFQIFGKGSKKAADEVWMARYLLLRLTEKYGVDIEFHCKPLGDT
FT                   DWNGSGMHCNFSTKFMREVGGKDYFEALMAAFAKNLDDHIAVYGPDNHMRLTGKHETAP
FT                   WNKFSYGVADRGASIRVPHSFIRNDYKGYLEDRRPNSQGDPYQIASQVLKTISEVDTKA
FT                   AAAA"
     atgacgaagt ataagctcga gtacatttgg ctcgacggct acaagccgac cccgaacctg        60
     cgcggcaaga cgcagatcaa ggaattcgac cacttcccct cgcttgagga gctcccgctg       120
     tggggcttcg acggttcgtc cacggagcag gccgagggtc gcagctccga ctgcgtgctg       180
     aagcccgtcg cgatctatcc cgatccggcc cgcaagaacg gcgccctggt gatgtgcgaa       240
     gtgatgatgc cggacggcgt caccccgcac gccaccaatg cgcgcgccac catcctggac       300
     gacgaaggcg cctggttcgg cttcgagcag gagtacttct tctacaagga cggccgcccg       360
     ctcggcttcc ccgagcacgg ctacccggcc ccgcagggcc cgtactacac cggcgtcggc       420
     ttcaagaatg tcggcgacat cgcccgcgag atcgtcgagg agcaccttga gctctgcctc       480
     gaggccggca tcaaccacga aggcatcaac gcggaagtcg cgaagggcca gtgggaattc       540
     cagatcttcg gcaagggctc caagaaggcc gccgacgaag tgtggatggc ccgctacctg       600
     ctgctccgcc tgaccgagaa gtacggcgtg gacatcgagt tccactgcaa gccgctcggc       660
     gataccgact ggaacggctc gggcatgcac tgcaacttct ccacgaagtt catgcgtgaa       720
     gtgggcggca aggactattt cgaggccctg atggcggctt tcgccaagaa cctcgacgac       780
     cacatcgccg tctacggccc ggacaaccac atgcgcctga ccggcaagca tgagacggcg       840
     ccgtggaaca agttctccta cggcgtggcc gaccgcggcg cttccatccg cgtgccgcac       900
     tcgttcatcc gcaacgacta caagggctat cttgaggatc gccgcccgaa ttcccagggc       960
     gacccctacc agatcgcttc ccaggtcctg aagacgatct cggaagtcga cacaaaggcc      1020
     gccgctgcgg cgtga                                                       1035
//

If you have problems or comments...

PBIL Back to PBIL home page