(data stored in ACNUC1104 zone)

EMBL: CP002026.PE411

CP002026.PE411       Location/Qualifiers
FT   CDS_pept        complement(420520..421950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0415"
FT                   /product="phospholipase D/Transphosphatidylase"
FT                   /note="PFAM: phospholipase D/Transphosphatidylase; KEGG:
FT                   bpt:Bpet3488 putative membrane-associated phospholipase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87748"
FT                   /db_xref="GOA:D7A330"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR027379"
FT                   /db_xref="UniProtKB/TrEMBL:D7A330"
FT                   /inference="protein motif:PFAM:PF00614"
FT                   /protein_id="ADH87748.1"
FT                   /translation="MLRFLSEYWPHITLVTSAAIGVVAAIHAAMTKDDVRAAIGWVGVI
FT                   LLSPFVGAFLYLVAGINRIRQSAAGRRRASQDRRRHHERPPIAIALSPSLSAMKRLGDR
FT                   VAAFPLTTGNAVELLDSGDAAYPAMLDAIRAAKRHVALSSYIFDNDPVGVQFADALIEA
FT                   HKRGVAVRVLIDAIGARYSRPSIVGRLMEGGVTVDLFMGNLIGLRLPYANLRSHRKMLI
FT                   VDGGLAFTGGMNIRAQFMAAFGGDDPARDTHFRVEGPAVEQLLTVFSQDWSFTTDEFLD
FT                   GPAWAEAPQGTHGPVAVRVVPSGPDRNLASAHNMIMGALAVAQSRVHVCSPYFLPDQQL
FT                   IGALTVAGRRGVEVDIVIPSANNLKLVDYAMTAQLDQVIAGECRVWRAEGMFDHSKLMA
FT                   VDGCWAYVGSSNLDPRSLRLNFELDLELYDPTIATAIETRVAAMMAASRPETLGTLARR
FT                   PFLEKLRNRAIWLASPYL"
     atgcttcgtt tcctgtcgga atactggccg cacataacgc tcgtcacgag cgccgccatc        60
     ggcgttgtgg cggcgatcca tgcggcgatg acgaaggacg atgtgcgcgc cgccatcggc       120
     tgggtcggcg tcatcctgct gtcgcccttc gtcggcgcct tcctctatct ggtcgccggc       180
     atcaaccgca ttcgccagag cgccgccggc cgccgccgcg ccagccagga ccgccggcgc       240
     caccatgagc gcccgcccat cgccatcgcc ctctcgccca gcctctcggc gatgaagcgg       300
     ctgggcgacc gcgtcgccgc cttcccgctc accaccggca atgcggtcga gctgctcgac       360
     agcggcgatg ccgcctatcc cgccatgctc gacgccatcc gcgcggcgaa gcggcatgtc       420
     gcgctctcca gctacatctt cgacaacgac ccggtcgggg tgcagttcgc cgatgcgctg       480
     atcgaggcgc acaagcgcgg cgtcgccgtg cgcgtgctga tcgatgccat cggcgcgcgc       540
     tattcgcgcc cctccatcgt cgggcggctg atggagggcg gcgtcaccgt cgaccttttc       600
     atgggcaatc tgatcggcct gcgcctgccc tacgcgaacc tgcgcagcca ccggaagatg       660
     ctgatcgtcg atggcggcct cgccttcacc ggcggcatga atatccgcgc ccagttcatg       720
     gccgcgttcg gcggcgacga tcccgcccgc gacacgcatt tccgcgtcga ggggccggcg       780
     gtggagcagt tgctcaccgt gttcagccag gactggtcct tcaccaccga cgagttcctc       840
     gacggcccgg cctgggcgga ggcgccgcag ggaactcatg gcccggtggc agtgcgcgtc       900
     gtgccctccg gccccgaccg caacctcgcc agcgcccaca acatgatcat gggcgcgctc       960
     gccgtggcgc agagccgcgt gcatgtctgc tcgccctatt tcctgcccga ccagcagctc      1020
     atcggcgcgc tcaccgtggc cgggcgccgg ggtgtcgagg tcgacatcgt catcccctcc      1080
     gccaacaatc tgaagctggt cgactacgcc atgaccgccc aactcgacca ggtgatcgcc      1140
     ggcgagtgca gggtgtggcg ggcagagggg atgttcgacc attccaagct gatggcggtg      1200
     gacggatgct gggcctatgt cggctcgtcc aacctcgacc cgcgcagcct gcggctcaat      1260
     ttcgagctcg acctcgaact ctacgatccg acgatcgcca cggcgatcga gacgcgcgtc      1320
     gccgcgatga tggccgcgtc gcggccggag acgctgggga cactggcgcg gcgccccttc      1380
     ctggagaagc tgcgcaaccg cgccatctgg ctggcctcgc cgtatttgtg a               1431
//

If you have problems or comments...

PBIL Back to PBIL home page