(data stored in ACNUC1104 zone)

EMBL: CP002026.PE413

CP002026.PE413       Location/Qualifiers
FT   CDS_pept        complement(424556..424978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0417"
FT                   /product="heat shock protein Hsp20"
FT                   /note="PFAM: heat shock protein Hsp20; KEGG: msl:Msil_3173
FT                   molecular chaperone (small heat shock protein)-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87750"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR031107"
FT                   /db_xref="InterPro:IPR040612"
FT                   /db_xref="UniProtKB/TrEMBL:D7A332"
FT                   /inference="protein motif:PFAM:PF00011"
FT                   /protein_id="ADH87750.1"
FT                   /translation="MKKTDPRLWMWSDAIDMLNRAERMHRQMFQPASRADAVSPRRHAP
FT                   CWEPPVDMIETERELIVLAALPGVDPERISVAIQNGTLAISGERVLPAELNRATIHRME
FT                   LPQGRFERQLVLPPGRYEVAHPRVVNGCLAIVLRKV"
     atgaagaaga ctgacccccg cctctggatg tggtcggacg ccatcgacat gctgaaccgc        60
     gccgagcgca tgcaccgaca gatgttccag ccggcctcgc gtgccgacgc ggtatcgccg       120
     cgccgccacg cgccgtgctg ggagccgccg gtcgacatga tcgagaccga gcgcgagctc       180
     atcgtgctcg ccgcgctccc cggcgtcgat cccgagcgca tcagcgtcgc catccagaac       240
     ggcacgctcg ccatttcggg cgagcgcgtg ctgccggcgg agctcaaccg cgccaccatc       300
     catcgcatgg agctgccgca gggccgcttc gagcgccagc tcgtgctgcc gcccggtcgc       360
     tacgaggtcg cccatccgcg cgtcgtcaac gggtgcctcg ccatcgtgct gcgtaaggtt       420
     tga                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page