(data stored in ACNUC1104 zone)

EMBL: CP002026.PE420

CP002026.PE420       Location/Qualifiers
FT   CDS_pept        431857..432882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0424"
FT                   /product="Inositol phosphatase/fructose-16-bisphosphatase"
FT                   /note="PFAM: Inositol
FT                   phosphatase/fructose-16-bisphosphatase; KEGG: xau:Xaut_3528
FT                   inositol phosphatase/fructose-16-bisphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87757"
FT                   /db_xref="GOA:D7A339"
FT                   /db_xref="InterPro:IPR000146"
FT                   /db_xref="InterPro:IPR020548"
FT                   /db_xref="InterPro:IPR028343"
FT                   /db_xref="InterPro:IPR033391"
FT                   /db_xref="UniProtKB/TrEMBL:D7A339"
FT                   /inference="protein motif:PFAM:PF00316"
FT                   /protein_id="ADH87757.1"
FT                   /translation="MIRPTLQDHLDRWSQADDSRRDVASAVLALAGAGIRISQLLAAGP
FT                   LAGALAAVRGHHADGDSQKELDVVADTLVREALAGTQVALFGSEEAEEAVALNPAGSLA
FT                   VAVDPLDGSSNIDTNMTVGTIFSILPYIGPASLLQPGSAQLAAGFLVYGPQTALALTVG
FT                   AGTQIFILDRASGDFLLAEERAMVLPETAEYAINGSNTRHWDLAIRCYVEDCQAGVDGP
FT                   RAKDFNTRWVASMVADVFRILVRGGVYLYPGDARRGYMQGRLRLVYEANPVAFLMEQAQ
FT                   GAATDGHRPILELEPTHLHQRVPLVFGSRAEVERIARYHHDAAAMPERSPLFGRRGLLR
FT                   A"
     atgatacgcc cgactttgca ggaccacctc gacaggtggt cgcaagccga tgattcgcgc        60
     cgcgacgtcg cgagcgccgt gctcgccctt gcgggcgccg gcatccgcat ctcgcagctt       120
     ctcgccgccg gcccgctggc gggtgcgctc gctgccgtgc gcggccacca tgccgatggc       180
     gacagccaga aggagctcga cgtcgtcgcc gacacgctgg tgcgcgaggc gctggccggg       240
     acgcaggtcg ccttgttcgg ttccgaggag gccgaggagg cggtggcgct gaacccggcc       300
     gggtcgctcg ccgtcgcggt cgatccgctg gacggctcgt ccaacatcga tacgaacatg       360
     acggtgggca cgatcttctc gatcctgccc tacatcggtc ccgcctcgct gctgcagccg       420
     ggctcggcgc agctcgccgc gggcttcctc gtctacgggc cgcagaccgc gctggcgctg       480
     accgtcggcg cgggcacgca aatcttcatc ctcgatcgtg cgagcggcga cttcctgctc       540
     gccgaggagc gggccatggt gctgccggag acggcggaat acgccatcaa cggttccaat       600
     acccgccact gggatctcgc catacgctgc tatgtcgagg actgccaggc cggcgtggac       660
     ggcccgcggg ccaaggactt caacacccgc tgggtcgctt ccatggtggc ggacgtcttc       720
     cgcatcctgg tgcgcggcgg cgtctatctc tacccgggcg acgcgcgccg cggctacatg       780
     cagggccggc tgcgcctcgt ctacgaggcc aatcccgtcg ccttcctgat ggagcaggcg       840
     cagggcgcgg cgacggacgg ccatcgcccg atcctcgagc tcgagccgac ccatctgcac       900
     cagcgcgtgc ccctcgtctt cggctcgcgc gccgaggtcg aacgcatcgc ccgctatcac       960
     cacgatgccg ccgccatgcc cgagcgctcg ccgctgttcg gccgtcgcgg cctgctgcgc      1020
     gcctga                                                                 1026
//

If you have problems or comments...

PBIL Back to PBIL home page