(data stored in ACNUC1104 zone)

EMBL: CP002026.PE422

CP002026.PE422       Location/Qualifiers
FT   CDS_pept        433785..435809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0426"
FT                   /product="transketolase"
FT                   /note="KEGG: rsp:RSP_3268 transketolase; TIGRFAM:
FT                   transketolase; PFAM: Transketolase domain protein;
FT                   Transketolase central region"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87759"
FT                   /db_xref="GOA:D7A341"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:D7A341"
FT                   /inference="protein motif:TFAM:TIGR00232"
FT                   /protein_id="ADH87759.1"
FT                   /translation="MLTRNAPTSQRPPQDLPEVLHDDMANALRALAMDAVEQAKSGHPG
FT                   MPMGMADVATALFSRFVKIDPTRPDWYDRDRVVLSAGHGSMLLYAVNHLLGYADMGTDQ
FT                   LRRFRQLGAVTAGHPEHGHTLGVETTTGPLGQGLATAVGMALAERMLNARFGDDLVDHY
FT                   TYVIAGDGCLMEGISHEAIDLAGHLKLGKLILLWDDNGISIDGRTTLSTSTDQLARFEA
FT                   AGWDVMRVDGHAYHAVTDAIAEARGTERPTLIACRTTIGFGAPTKAGTEGAHGAPLGPD
FT                   EIAGARARLGWSHPPFEVPDDVREAWAHTAARGRTAREAWERRLSGSGRRAAFEAAMEG
FT                   ELPADFDEKLDAYKRELSQSAPKVATRKASEMALGVINAETELTVGGSADLTHSNLTYT
FT                   KGLMPVTPGNFAGRYLHYGIREHAMAAVMNGLALHRGTIPYGGTFLVFSDYARGAMRLS
FT                   ALMGQRVVYVLTHDSIGLGEDGPTHQPVEHLAMLRATPNLHVFRPADAVETLEAWQLAL
FT                   HAERTPSVLALSRQNLPTFRTTHSEENLTGYGAYVARKPERRRDVTLLATGSEVELAFK
FT                   AADMLALRGVDAAVVSMPCWELFEKQSADYRRAVLGTAPRVAVEAAARFGWDRWIGERG
FT                   RFVGMEGFGASAPAADLYRYFNITPEAVVAAACDLITCA"
     atgctcaccc gaaacgcccc gacgtcccag cgtccgcccc aagacctgcc ggaagtgctg        60
     cacgacgaca tggccaatgc gctgcgcgcg ctcgccatgg atgcggtcga acaggccaag       120
     tccggccatc ccggcatgcc catgggcatg gcggatgtcg ccaccgcctt gttcagccgc       180
     ttcgtgaaga tcgatccgac ccgcccggac tggtacgacc gcgaccgcgt cgtgctctcg       240
     gccggccacg gctcgatgct gctctacgcc gtcaaccacc tgctcggcta tgccgacatg       300
     ggcaccgacc agctcaggcg cttccgccag ctcggcgcgg tcaccgccgg ccatcccgag       360
     cacggccaca cgctcggcgt cgagaccacc accggcccgc tgggccaggg gctcgccacc       420
     gcggtcggca tggcgctcgc cgagcgcatg ctcaacgccc gcttcggcga cgacctcgtc       480
     gaccactaca cctacgtcat cgccggcgac ggctgcctga tggaaggcat cagccacgag       540
     gccatcgacc tcgccgggca cctcaagctc ggcaagctga tcctcctgtg ggacgacaac       600
     ggcatctcca tcgacgggcg caccacgctc tcgacctcga ccgaccagct cgcccgcttc       660
     gaggcggccg gctgggacgt gatgcgcgtc gacggccacg cctatcacgc ggtgaccgac       720
     gcgatcgccg aggcccgcgg cacggagcgt ccgacgctca tcgcctgccg caccaccatc       780
     ggcttcggcg cgcccaccaa ggcgggcacg gaaggcgccc atggcgcgcc gctcggcccc       840
     gacgagatcg ccggcgcccg cgcccggctc ggctggagcc atccgccctt cgaggtgccg       900
     gacgacgtcc gcgaggcctg ggcgcatacc gccgcgcgcg gccgtaccgc ccgcgaggcc       960
     tgggagcggc gcctgtccgg ttccggccgc cgcgccgcct tcgaggcggc gatggaaggc      1020
     gaactgcccg ccgatttcga cgagaagctc gacgcctaca agcgcgagct gtcgcagagc      1080
     gcgccgaagg tcgcgacccg caaggcgtcg gagatggcgc tcggggtcat caatgccgag      1140
     accgagctca cggtcggcgg ctcggccgac ctcacccatt ccaacctcac ctacaccaag      1200
     ggcctgatgc cggtgacgcc cggcaacttc gccggccgct acctgcatta cgggatccgc      1260
     gagcacgcca tggcggcggt gatgaacggc ctcgccttgc atcgcggcac catcccctac      1320
     ggcgggacct tcctggtctt ctccgactat gcgcggggcg ccatgcggct ctcggcgctg      1380
     atgggccagc gcgtcgtcta tgtgctgacg cacgactcca tcggcctcgg cgaggacggg      1440
     ccgacgcacc agccggtcga gcacctcgcc atgctgcggg cgacgccgaa cctgcatgtg      1500
     ttccgccccg ccgacgcggt ggagacgctg gaagcctggc agctcgcctt gcatgcggag      1560
     cgcacgccct cggtgctggc gctgtcgcgg cagaacctgc cgaccttccg caccacgcac      1620
     agcgaggaga acctcaccgg ctacggcgcc tatgtcgccc gcaagcccga gcgccggcgc      1680
     gacgtgacgc tgctggcgac cggctcggaa gtcgagctcg cctttaaggc ggccgacatg      1740
     cttgcgctgc gcggcgtcga cgccgccgtc gtctccatgc cctgctggga gctgttcgag      1800
     aagcagagcg cggattatcg ccgcgccgtg ctcggcaccg ccccgcgcgt cgcggtggag      1860
     gcggctgccc ggttcggctg ggaccgctgg atcggtgagc gcggccgctt cgtcggcatg      1920
     gagggcttcg gcgcctcggc gccggccgcc gacctctaca ggtacttcaa catcacgccg      1980
     gaggcggtcg ttgccgctgc ctgcgacctc atcacctgcg cctga                      2025
//

If you have problems or comments...

PBIL Back to PBIL home page