(data stored in ACNUC1104 zone)

EMBL: CP002026.PE423

CP002026.PE423       Location/Qualifiers
FT   CDS_pept        435821..436906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0427"
FT                   /product="fructose-bisphosphate aldolase, class II, Calvin
FT                   cycle subtype"
FT                   /EC_number="4.1.2.13"
FT                   /note="TIGRFAM: fructose-bisphosphate aldolase, class II,
FT                   Calvin cycle subtype; ketose-bisphosphate aldolase; KEGG:
FT                   nha:Nham_4048 fructose-1,6-bisphosphate aldolase; PFAM:
FT                   ketose-bisphosphate aldolase class-II"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87760"
FT                   /db_xref="GOA:D7A342"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006412"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D7A342"
FT                   /inference="protein motif:TFAM:TIGR01521"
FT                   /protein_id="ADH87760.1"
FT                   /translation="MARITLRQLLDHAAEHGYGVPAFNINNMEQGIAIMDAAQAVDAPV
FT                   IMQASRGARSYAGDIMLARMIDALTEMYPSIPICMHQDHGNNEATCLSAIQHGFTSVMM
FT                   DGSLKADAKTPADYDYNVTITRRVVDAAHWVGASVEGELGVLGSLEHGSGEQEDGHGAE
FT                   GALSHDQLLTDPDQAVDFVARTKVDALAIAMGTSHGAYKFTRKPDGDILAMHVIEEIHR
FT                   RLPSVHLVMHGSSSVPQALQDLFNASGGEMPQTWGVPVEEIVRGIRHGVRKVNIDTDCR
FT                   LAMTAQFRKVGQANRSEFDPRKFLKPAMDAMRDLCRERFEQFGTAGHAAQIKVLPLAAM
FT                   AKRYASGALDPVIGGAQAAAE"
     atggcccgca tcacccttcg ccagctcctc gaccatgccg ccgagcacgg ctacggcgtg        60
     cccgccttca acatcaacaa catggagcag ggcatcgcca tcatggacgc cgcccaggcg       120
     gtcgatgctc ccgtcatcat gcaggcgagc cgcggcgcgc gctcctatgc cggcgacatc       180
     atgctcgccc gcatgatcga cgcgctgacc gagatgtatc cgtcgatccc gatctgcatg       240
     catcaggacc acgggaacaa cgaggcgacc tgcctctccg ccatccagca cggcttcacc       300
     tcggtgatga tggacggctc gctgaaggcg gacgccaaga ccccggcgga ctacgactac       360
     aacgtcacca tcacccgccg cgtggtcgac gccgcccatt gggtcggcgc ctcggtcgag       420
     ggcgagctcg gcgtgctcgg ctcgctggag cacggctcgg gcgagcagga ggacggccac       480
     ggcgcggagg gcgcgctcag ccacgaccag ctgctcaccg atcccgacca ggcggtggac       540
     ttcgtcgccc gcaccaaggt cgacgcgctc gccatcgcca tgggcacctc gcacggcgcc       600
     tacaagttca cccgcaagcc ggacggcgac atcctcgcca tgcatgtgat cgaggagatc       660
     caccgccggc tgccgagcgt ccacctcgtc atgcacggct cctcctcggt gccgcaggcg       720
     ctgcaggacc tgttcaacgc ttccggcggc gagatgcccc agacgtgggg cgtgccggtc       780
     gaggagatcg tgcgcggcat ccgccacggc gtgcgcaagg tgaacatcga caccgactgc       840
     cgtctcgcca tgaccgcgca gttccgcaag gtcgggcagg ccaacaggtc ggaattcgac       900
     ccgcgcaaat tcctcaagcc cgccatggac gcgatgcgcg acctctgccg cgagcgcttc       960
     gagcagttcg gtacggcggg ccacgccgcg cagatcaagg tgctgccgct ggcagcgatg      1020
     gccaagcgct acgcctcggg cgcgctcgat ccggtgatcg gcggcgccca ggcggcggcg      1080
     gaatga                                                                 1086
//

If you have problems or comments...

PBIL Back to PBIL home page