(data stored in ACNUC1104 zone)

EMBL: CP002026.PE430

CP002026.PE430       Location/Qualifiers
FT   CDS_pept        complement(443324..444001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0434"
FT                   /product="SNARE associated Golgi protein-like protein"
FT                   /note="PFAM: SNARE associated Golgi protein; KEGG:
FT                   oan:Oant_1851 SNARE associated Golgi protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87767"
FT                   /db_xref="GOA:D7A349"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:D7A349"
FT                   /inference="protein motif:PFAM:PF09335"
FT                   /protein_id="ADH87767.1"
FT                   /translation="MEAIAADLAAFMRGHEYLVPVVIGLIAFAESLVLVGLVVPATALM
FT                   LAIGGLIGSGILSPVPVISGAIVGAALGDIVSYWLGRWVGPRVVHRWPLQGYRHQVAQA
FT                   RLFFRRFGFASVFVGRFFGPVRATMPLVAGMMRMDQRRFQFANVSSAIVWAPVMLAPGW
FT                   IAGKGANQLGAASSGEWLVLMVGITLVMLIATAVILRVVQGRIAKRPRNRRAARTSARA
FT                   SAG"
     atggaagcaa ttgctgcgga tttggccgcc ttcatgcgcg gccatgaata cctcgtgcct        60
     gtcgtcatcg gcctcatcgc cttcgccgaa tccctcgtcc tggtcggcct tgtcgtcccc       120
     gccacggcac tgatgctcgc gatcggcggg ctgatcggct cgggcatcct ctccccggtc       180
     ccggtgatca gtggtgccat cgtcggcgcc gcgctcggtg acattgtctc ctactggctc       240
     ggccgctggg tcggcccgcg ggtggtgcat cgctggccgc tgcagggcta tcgccaccag       300
     gtggcacagg cgcggctgtt cttccgccgc ttcggcttcg cctcggtgtt cgtcggccgc       360
     ttcttcgggc cggtgcgcgc gaccatgccg ctggtcgccg gcatgatgcg catggaccag       420
     cgccgcttcc agttcgccaa cgtctcctcg gccatcgtct gggcaccggt gatgctggcg       480
     ccgggctgga tcgccggcaa gggcgccaac cagctcggcg ccgccagcag cggcgaatgg       540
     ctggtgctga tggtggggat caccctggtc atgctcatcg cgactgccgt catcctgcgg       600
     gtggtgcagg ggcggatcgc caagcgcccg cgcaaccgcc gcgccgcgcg tacctccgcc       660
     cgcgcctcgg ccggctga                                                     678
//

If you have problems or comments...

PBIL Back to PBIL home page