(data stored in ACNUC1104 zone)

EMBL: CP002026.PE432

CP002026.PE432       Location/Qualifiers
FT   CDS_pept        444523..446907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0436"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="PFAM: MscS Mechanosensitive ion channel; KEGG:
FT                   azc:AZC_2392 mechanosensitive ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87769"
FT                   /db_xref="GOA:D7A351"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:D7A351"
FT                   /inference="protein motif:PFAM:PF00924"
FT                   /protein_id="ADH87769.1"
FT                   /translation="MLANGPRTTECFMPLRAIPGILLLALCVTFAAPLKAQTLASPPAQ
FT                   PAQTTPESTRPEGTRQDLRALLDTLEDDAARTAFLARLRALVESGTVAPEPAAPERDDW
FT                   LAGATRSLGSFSNSVLGLVGEIEQLPEQAERFFEDLSDPLVLQRVGWAAIMVITVLAAA
FT                   LLAEYVAKLLLSRLRRAVEARHARGLPMRALLLGIRTVLDILPIAAFAAASFGVLALVE
FT                   LNFVIRLAVVTVINANVLARLILAAGRAVLTPDAPHLRLFPLENESAAYGYLWVRRFAY
FT                   TVVYGYFLLRAAWVLGLALPTYHFLSHALGLFVAGMCIVFILQIRAGVAARLRRIGARE
FT                   GRAARLRDTVADFWHVLLIAYVVAAYIVRVFDVAGGFAFLTQATLLSLLTVALAALAIS
FT                   LLLRAFDKVFRLNGEMRERYPLLEARANRYLPALRSGMQGLVLAVATLVLLEIWGARPF
FT                   EWLASDHGQGAVGRLISIGVVVLAGLIAWELATVFSERLRAGNPSSTRLKTLLPFLQNA
FT                   FRVVLLTLGGLILLSEIGVNIAPLLAGAGVLGLAIGFGAQTLVKDVITGIFILMEDTIS
FT                   VGDVVEVGAHSGLVEKISIRTVHMRDFDGNVHSIPFGEVQTIKNMSKDFAYAVIDVRVS
FT                   YRENIDEALALMSEVAADMAAKGPLAETIVAPFEVVGVEALEESYIWLRGRFKTRPLGQ
FT                   WNVKREFYRRIKAAFDARGIEIPYPHRTVYLGTDKKGEAPPLRLVSQRPEDLSAPQRAR
FT                   RAEAARAARTPGPLIEEHPGARERSEEDEEPMLPTIEERRH"
     atgctggcca atgggccgcg aacgacggaa tgcttcatgc cgctgcgcgc gatacccggc        60
     atcctgctgc tcgccctttg cgtcaccttc gccgcgccgc tcaaggcgca gacgctcgct       120
     tccccgccgg cccagccggc acagacgacg cccgagagca cgcggcccga gggcacgcgg       180
     caggatctgc gcgcgctgct cgacacgctg gaggacgacg cggcgcggac ggctttcctc       240
     gcccggctgc gtgcgctcgt cgagagcggc accgttgcgc cggaaccggc ggcgccggag       300
     cgcgacgact ggctggcggg cgccacccgg tcgctcggca gcttctccaa ctcggtcctc       360
     ggcctggtcg gcgagatcga gcaactgccg gaacaggccg aacgcttctt cgaggatcta       420
     tccgatccgc tggtgctcca gcgcgtcggc tgggcggcga taatggtcat caccgtcctc       480
     gcggcggcgc tgctggcgga atatgtcgcc aaattgctgc tctcccgcct gcgccgggcg       540
     gtggaagcgc gccacgcgcg gggtcttccc atgcgggctc tgctgctcgg catacgcacg       600
     gtgctcgaca tattgcccat cgccgccttt gccgccgcgt ccttcggcgt gctggcgctg       660
     gtcgagctca atttcgtcat ccggctcgcc gtggtcacag tgatcaacgc caatgtgctg       720
     gcgcggctca tcctcgccgc cggcagggcc gtgctgacgc cggacgcgcc gcatctgcgg       780
     ctgttcccgc tggagaatga gagcgcggcc tatggctatc tgtgggtcag gcgcttcgca       840
     tacaccgtcg tctacggcta tttcctgttg cgcgccgcct gggtgctcgg cctcgccctg       900
     ccgacctacc acttcctcag ccatgcgctc ggcctgttcg tcgccggcat gtgcatcgtg       960
     ttcatcctgc agattcgcgc cggcgtcgct gcgcgcctgc gccgcatcgg cgcgcgggaa      1020
     ggccgcgcgg cgcggctgcg cgatacggtg gcggacttct ggcatgtgct gctgatcgcc      1080
     tacgtcgtcg ccgcctacat cgtccgtgtg ttcgatgtcg ccggcggctt cgccttcctc      1140
     acccaggcga cgctgctctc gctcctcacc gtcgcgcttg ccgcgctggc gatctcgctg      1200
     ctgctgcggg ccttcgacaa ggtgttccgg ctgaacggcg agatgcgcga gcgctacccg      1260
     ctgctggagg cgcgcgccaa ccgctatctg cccgcgctgc gcagcggcat gcaggggctg      1320
     gtgctcgcgg tcgccacgct ggtgctgctg gagatatggg gcgccaggcc gttcgaatgg      1380
     ctggcctccg accacggcca gggcgcggtc ggccggctca tttccatcgg cgtggtggtg      1440
     ctggccgggc tgatcgcctg ggagcttgcc accgtcttct ccgagcgtct gcgcgccggc      1500
     aatcccagct ccacccggct gaagacgctg ctgcccttcc tgcagaacgc cttccgcgtg      1560
     gtgctgctga cattgggcgg gctgatcctg ctctccgaga tcggggtcaa catcgccccg      1620
     ctgctggccg gcgccggcgt gctcggcctc gccatcggct tcggcgcgca gacgctggtg      1680
     aaggacgtga tcaccggcat cttcatcctg atggaggaca ccatctcggt cggcgacgtg      1740
     gtggaggtcg gcgcccatag cgggctggtg gagaagatca gcatccgcac cgtccacatg      1800
     cgcgacttcg acggcaacgt gcactcgatc cccttcggcg aggtgcagac catcaagaac      1860
     atgtcgaagg acttcgccta tgcggtcatc gacgtgcgcg tctcctatcg cgagaacatc      1920
     gacgaggcgc tggcgctgat gtcggaggtg gcggcggaca tggcggcgaa ggggccgctg      1980
     gccgagacca tcgtcgcgcc cttcgaggtg gtgggggtgg aggcgctgga ggagagctac      2040
     atctggctgc gcggccgctt caagacccgt ccgctcggcc agtggaacgt caagcgcgag      2100
     ttctaccgcc gcatcaaggc ggcgttcgac gcgcgcggca tcgagatccc gtacccgcac      2160
     cgcaccgtct atctcggcac cgacaagaag ggcgaggcgc cgccgctgcg cctcgtcagc      2220
     cagcggccag aggacctctc cgcgccccag cgtgcccgcc gggccgaggc cgcccgtgcc      2280
     gcccgcacgc ccggtccgct gatcgaggag catcccggcg cgcgcgagcg cagcgaggag      2340
     gacgaggagc cgatgctccc gaccatcgag gagcgccggc actga                      2385
//

If you have problems or comments...

PBIL Back to PBIL home page