(data stored in ACNUC1104 zone)

EMBL: CP002026.PE433

CP002026.PE433       Location/Qualifiers
FT   CDS_pept        447142..448122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0437"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="PFAM: secretion protein HlyD family protein; KEGG:
FT                   msl:Msil_0234 secretion protein HlyD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87770"
FT                   /db_xref="GOA:D7A352"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:D7A352"
FT                   /inference="protein motif:PFAM:PF00529"
FT                   /protein_id="ADH87770.1"
FT                   /translation="MLSRLLRHPVTLIVGVVVALFVIYEISVRFFAYTADAYVMSDIVV
FT                   ISSQIEGPVSKLAVQNNQTVAANQLLFEIERTPFALKVQEAQASLAQAQANLGLAQDEV
FT                   NAAKANIASAQAIQANAQEQLNRIKTLSGEGFSPEAQLDVATRDVATAGANVSSTQAQL
FT                   AVATQRVTVANAAIGSTQAELARAEYDLSKTVVAAPEAGRITPFTTRLGDYLRPGTEVL
FT                   AIITDRRRRVVANMNERHLERIRIGQRVLLTLGNDPWQLHLGRVSGIAAGVARSPHNPE
FT                   IVPYVEPTTDWVRLPRRFPIEIELDDWPAGVGLFNGADARVLIWF"
     atgttgagtc gccttctccg ccatccggtg acgctgatcg tcggcgtggt ggtcgcgctt        60
     ttcgtcatct acgagatcag cgtgcgcttc ttcgcctata cggcggacgc ctatgtgatg       120
     agcgacatcg tcgtcatctc ctcgcagatc gaggggccgg tctcgaagct tgcggtgcag       180
     aacaaccaga cggtcgcggc gaaccagttg ctgttcgaga tcgagcgcac gcccttcgcg       240
     ctgaaggtcc aggaggcgca ggcgtcgctg gcgcaggcgc aggccaatct cggcctggcg       300
     caggacgagg tgaacgccgc caaggccaac atcgcttccg cccaggcgat ccaggccaat       360
     gcgcaggagc agctgaaccg catcaagacg ctgtcggggg agggcttctc gccggaggcg       420
     cagctcgacg tcgccacccg tgacgttgcc accgccggcg cgaacgtctc ctccacccag       480
     gcccaactcg ccgtggcgac ccagcgtgtc accgtggcga atgcggcgat cggctccacc       540
     caggcggagc tggcgcgggc cgaatacgac ctctccaaga ccgtggtggc ggcgccggag       600
     gcggggcgga tcacgccctt caccacgcgg ctcggcgact atctgcggcc gggcaccgag       660
     gtgctggcga tcatcaccga tcgccgccgg cgcgtggtcg ccaacatgaa cgagcgccat       720
     ctggagcgca tccgcatcgg ccaacgcgtg ctgctgaccc tcggcaacga tccctggcag       780
     ctgcatctcg ggcgggtgag cggcatcgcc gccggcgtcg cgcgctcgcc gcacaatccc       840
     gagatcgtgc cctatgtcga gccgaccacc gactgggtgc gtctgccccg gcgcttcccg       900
     atcgagatcg agctcgacga ctggccggcg ggcgtcggcc tgttcaacgg cgccgatgcc       960
     cgcgtgctga tctggttcta g                                                 981
//

If you have problems or comments...

PBIL Back to PBIL home page