(data stored in ACNUC1104 zone)

EMBL: CP002026.PE434

CP002026.PE434       Location/Qualifiers
FT   CDS_pept        448240..449238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0438"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: msl:Msil_0235 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87771"
FT                   /db_xref="GOA:D7A353"
FT                   /db_xref="InterPro:IPR006726"
FT                   /db_xref="UniProtKB/TrEMBL:D7A353"
FT                   /inference="similar to AA sequence:KEGG:Msil_0235"
FT                   /protein_id="ADH87771.1"
FT                   /translation="MDDVTRHAFATATGVLAAVYISLAMGWQDPYWAALSVMIIANVDR
FT                   DALFTKGVLRITGTFIGVIGGYYVGQWAEGLNALQAALVMIAAAVGTYGRQRSAYGYAW
FT                   FYGGLTFALVMLYTMTQPEQLYDFAWYRCYEIVTGVVCGTLASWALGPRAGELHARLVA
FT                   QAAATSQVNAERQSMVAAVGALIIIVTWSLFDLPQLPQVLISSLIIIDNDPVASRHRGA
FT                   QRIFGCIIGGTAGLVVIGLDATDMWWWVTMLFLGVFTFARIHLGGTTQAYIGTQSAIAY
FT                   LVTLVGTGPPTTLEPPIDRLVGIVIGVSIMTTLVWAFNSVKPAEKVADGPA"
     atggacgacg tcacgcggca tgccttcgcc accgccaccg gggtgctcgc cgccgtctac        60
     atctcgctgg ccatgggatg gcaggacccg tactgggccg cgctcagcgt aatgatcatc       120
     gccaatgtcg accgcgatgc gctgttcacc aagggcgtgc tgcgcatcac cggcaccttc       180
     atcggggtga tcggcggcta ctatgtcggc cagtgggccg aggggctgaa cgcgctgcag       240
     gcggcgctgg tgatgatcgc cgcggcggtc ggcacctatg gccgccagcg cagcgcctat       300
     ggctatgcct ggttctatgg cgggctgacc ttcgccctcg tcatgctcta caccatgacg       360
     cagcccgagc agctctacga cttcgcctgg tatcgctgct acgagatcgt taccggcgtg       420
     gtctgcggca cgctggcgag ctgggcgctc gggccgcgcg caggcgaact gcacgcccgc       480
     ctcgtcgcgc aggcggcggc gaccagccag gtcaatgccg agcgccagtc gatggtcgcg       540
     gcggtcggcg cgttgatcat catcgtcacc tggtcgctgt tcgacctgcc gcagctgccg       600
     caggtgctga tctccagcct catcatcatc gacaacgacc cggtggcgag ccgccatcgc       660
     ggcgcgcagc gcatcttcgg ctgcatcatc ggcggcacgg ccgggctggt cgtgatcggg       720
     ctcgacgcca ccgacatgtg gtggtgggtg acgatgctgt tcctcggcgt gttcaccttc       780
     gcccgcatcc atctcggcgg gacgacgcag gcctatatcg gcacgcagtc ggcaatcgcc       840
     tatctggtga cgctggtggg caccggcccg ccgaccacgc tggagccgcc gatcgaccgc       900
     ctcgtcggca tcgtcatcgg ggtgagcatc atgaccacgc tggtctgggc gttcaattcg       960
     gtgaagccgg cggagaaggt ggcggacgga ccggcctga                              999
//

If you have problems or comments...

PBIL Back to PBIL home page