(data stored in ACNUC1104 zone)

EMBL: CP002026.PE437

CP002026.PE437       Location/Qualifiers
FT   CDS_pept        complement(452938..454239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0441"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="KEGG: xau:Xaut_0320 RND family efflux transporter
FT                   MFP subunit; TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87774"
FT                   /db_xref="GOA:D7A356"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:D7A356"
FT                   /inference="protein motif:TFAM:TIGR01730"
FT                   /protein_id="ADH87774.1"
FT                   /translation="MSNDNLGNDAGSSQIVHVEIARDVASQHKRHRWREAGVVLTLAAL
FT                   ATGAAVFLAWPSSNALATDPAPAAAAPPAMPVAVAVLEPRDTMKWDEFSGRLQAVERVE
FT                   VRPRVAGAVKTIHFREGALVKQGELLVTIDPEPFQAELDRAEAQSAAAEARLLFTKNEL
FT                   DRGQKLVDSRVVSVQDLDQRTNNYKEAQANLRAAQADVQTAKLDLGYTEVRAPVDGRVG
FT                   RIDVTVGNLVSAGPTSPVLTTLVSVDPIYVGFAADEGAVSEALATLGNGDVLGEIDRIP
FT                   VEITTATTGEKPARGHLQLVDNQVDTATGTFRLRAVFDNPDGRLVPGQFARVRMGRAKT
FT                   EPALVINERAIGTDQDKKYVFVVDPENKAVYREVKLGPPSEGLRVVASGLKEGERIVVN
FT                   GLQRVRPGALLAPEIVPMNTTASAANPNTSVAAR"
     atgagcaacg acaacctcgg caacgacgct ggttcgagcc agatcgtaca cgttgagatc        60
     gctcgcgacg ttgcgtcgca gcataagcgc caccgctggc gggaggccgg cgtcgtcctg       120
     acgctggcgg cgctcgctac cggcgcggcg gtgttcctgg cttggccgag cagcaacgcg       180
     ctggcgaccg atccggcgcc cgccgcggcc gctccgccgg ccatgccggt cgcggtggcg       240
     gtgctggagc cgcgcgacac catgaaatgg gacgagttct ccggccgcct gcaggcggtg       300
     gagcgcgtcg aggtgcgccc gcgcgtcgcc ggcgcggtga agaccatcca tttccgcgag       360
     ggcgcgctgg tgaagcaggg cgagctgctc gtcaccatcg atcccgagcc cttccaggcc       420
     gagctggacc gcgccgaggc gcagtccgcc gccgccgagg cgcggctgct gttcaccaag       480
     aacgagctcg accgcggcca gaaactggtc gattcccgcg tcgtctcggt gcaggacctc       540
     gaccagcgca ccaacaacta caaggaagcg caggccaatc tacgtgccgc gcaggccgat       600
     gtgcagaccg ccaagctgga cctcggctac accgaggtgc gcgcgccggt cgacggccgc       660
     gtcggccgca tcgacgtgac ggtcggcaac ctcgtctcgg ccgggcccac ctcgcccgtg       720
     ctgaccacgc tggtctcggt cgacccgatc tatgtcggct tcgcggccga cgaaggtgcg       780
     gtgagcgagg ccctcgccac gctcggcaac ggcgacgtgc tgggcgagat cgaccgcatc       840
     ccggtcgaga tcaccaccgc caccaccggc gagaagccgg cgcgcggcca tctccagctc       900
     gtcgacaacc aggtcgatac cgccaccggc accttccgcc tgcgcgccgt gttcgacaat       960
     ccggacggcc gtctcgtgcc gggccagttc gcccgcgtgc gcatgggccg ggccaagacc      1020
     gagccggcgc tcgtcatcaa cgagcgcgcc atcggcaccg accaggacaa gaagtacgtc      1080
     ttcgtggtcg atccggagaa caaggccgtc tatcgcgagg tcaagctcgg cccgccgagc      1140
     gagggcctgc gcgtggtggc gagcggcctg aaggaaggcg agcgcatcgt cgtcaacggc      1200
     ctgcagcgcg tgcgtcccgg cgcgctgctg gcgccagaaa tcgtgccgat gaacacgacc      1260
     gccagcgcgg cgaaccccaa cacttccgtc gccgcgcgct ga                         1302
//

If you have problems or comments...

PBIL Back to PBIL home page